SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026305 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026305
Domain Number 1 Region: 573-643
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000014
Family Ankyrin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026305
Domain Number - Region: 233-260
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00753
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.04
Further Details:      
 
Domain Number - Region: 326-348
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0238
Family Ribosomal protein L32p 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026305   Gene: ENSGACG00000019911   Transcript: ENSGACT00000026356
Sequence length 650
Comment pep:known_by_projection group:BROADS1:groupIX:19995573:20000085:-1 gene:ENSGACG00000019911 transcript:ENSGACT00000026356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGAVSAPLIIPMIHLQTHRAKNHIDTNTPVSIQSDTPDVLIFYTLDGSKPSFGPRESK
GSRRYGGPILLPAGRVAVRAVAVTRDGRDSSTVTKVFSVELVESNEDQSLKLFSFQRQCE
GTLISSGPLLKPSGINMCNNIINIVCDNITVKLRPPSGGLLTGGLGSPTKPQPAGSSQPS
QSAASRQQTDFLRCAQCQRPRPSDPFCGFRAQCGPSLPVLDEQRRRPAEGGQVLRCVLCN
SLVPVNTHTCLICEAAVHQQQPQSSGARPRLSSPVPPVGSAACRTWRCFSTKTGASVHLN
GWMERGEKFEPVFVLSLCGEPGHAASYVVCWRCGANGPPHAFYCATCGAFLEAPPPPTSC
GDITQPVGAAATLQGSAPWRARRPSGPPPPPKVTTPSKDQSTQTSSASELQRKETQRKLQ
LSKQHSARDQRPPLTSISPGRGFWRKQLDHLCAHLRSYAQNNAPFRTLLGEPRLGQMVSA
AIQEDRYEVSLTFSFVSAGGRQRQVEQAADGLGPPAGTETLGATIEPSVDCQRGTWSEDK
ANDANDAHRPTLRPRPPVRDVQLLKELGPGPGRGRISIIQQLLDQGADPSCCDANGRHAL
AVAVVNGHHDVLPVLVQRGADVDQQSGEMKNTALHEAAALGSEGLKAAEV
Download sequence
Identical sequences G3Q8U1
ENSGACP00000026305 69293.ENSGACP00000026305 ENSGACP00000026305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]