SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026379 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026379
Domain Number 1 Region: 241-342
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-25
Family PDZ domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 730-821
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family PDZ domain 0.000026
Further Details:      
 
Domain Number 3 Region: 582-685
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-22
Family PDZ domain 0.0000903
Further Details:      
 
Domain Number 4 Region: 412-519
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-19
Family PDZ domain 0.0000835
Further Details:      
 
Domain Number 5 Region: 126-163
Classification Level Classification E-value
Superfamily WW domain 0.000000000000682
Family WW domain 0.0011
Further Details:      
 
Domain Number 6 Region: 926-1000
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000226
Family PDZ domain 0.0003
Further Details:      
 
Domain Number 7 Region: 173-208
Classification Level Classification E-value
Superfamily WW domain 0.00000000431
Family WW domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026379   Gene: ENSGACG00000019967   Transcript: ENSGACT00000026430
Sequence length 1231
Comment pep:known_by_projection group:BROADS1:groupIV:31446944:31485343:1 gene:ENSGACG00000019967 transcript:ENSGACT00000026430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSVPDNFYGTPKPPAEPSALLLNVTDQLLPGARPTAEGKRKRNKSVSNMEKAGVEPPEE
EEDERPVVNGNGVAVTPAESSEHEDKSTDASGDAAPQSLPAEAPPEAPKEDGQSPKMTLP
KPEENEELGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKEDELPYG
WEKIDDPIYGSYYVDHINRRTQFENPVLEAKRRLQQQQQMQSQGLSSLPLPTIYREKPLF
TRDPTQLKGSFLSTALQKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAADGKMATGDVI
VYINDVCVLGTTHADVVKLFQSVPIGQSVTLVLCRGYPLPYDPEESPLGIMEQRPVMVNG
RTGYDNYLDYLSRTARFVADAPGQDQGGAQQLLAPHPGDTHLDGSLPPATGATPPDSVSM
ASSGATQGELLTLTMVKGPEGFGFTIADSGAGQRVKQVLEPQGCPGLCEGDLIVEINKQL
VQGYDHAQVVELLKECAVGAETILVVQRGGAGHYSPWKSPKQVLEQWESQQTSPSAPVIP
HNAPFPARHLHRASEAAAPAKPDPFDLYEKSRAIYESRQPGQPRTVYPVDCSGADYQDME
VHLRRHKSGFGFRVLGGDEAGQPILIGAIIEKSPADVDGRLRPGDELLFVDAIPVVGKPH
RYVIDLMHGAARNGQVNLVVRRRLQAAGESCPANGRSPGSVSTQHSSPRSDFTYANSTDR
TSAPNALPSDVVINRKESEGFGFVIISSLNRPEAAGANAVPHKIGRIIEGSPADRCGKLK
VGDRILAVNGQSIVSMPHADIVKLIKDAGLGVTLRIVPQEEISNPPSAPTSEKQSPMAQQ
HSPKTRTRPARPSDPPAPTYAHESSYRSEVKARQDVKPDIRQPPFTDYRQPPVDYRHPPV
ADYRQPPTLDYRHPPLLDYRQLAADTRQFTLPDYRMPPVQDFDFFTVELEKSAKGFGFSI
RGGREYKMDLFVLRLAEDGPAIRNGRMRIGPRFLSLMGFSKKKRLHSQPRLIIGSRGRRC
IVRGLRATGGAPDNPAPWDARPSASPSLPEVAPPIDSLSTPSPSSHPAADPPRLPPPDFL
RDPVARDGGTERSKSPRRGEPPNPEPLGPGRRAASARKEGGRSTRVGHAARPAAEREGQS
GEPKPPRGTRGRSQERNTEPPGSSKLPHTNGNGVLDAERPGGGGPGESRPGPPCKGGAAG
RKATVSPGPWKIPGSDRLPGSLRAGTSTLSR
Download sequence
Identical sequences G3Q915
69293.ENSGACP00000026379 ENSGACP00000026379 ENSGACP00000026379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]