SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026393 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026393
Domain Number 1 Region: 108-172
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000465
Family PHD domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026393   Gene: ENSGACG00000019979   Transcript: ENSGACT00000026444
Sequence length 260
Comment pep:known_by_projection group:BROADS1:groupIV:31545943:31551414:1 gene:ENSGACG00000019979 transcript:ENSGACT00000026444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIVIPVGVDTADASYLDMAAGSEPESVEASPVVVEKSSYPHQIYSSGSHHSHSYIGLPY
ADHNYGARPPPTPPASPPPSMLIRQGEGGLFVPGGQDEASRGTTLSTSEDGSYGADITRC
ICGFTHDDGYMICCDKCSAWQLIDCMGIDRQNIPETYLYERCQPRHLDRERAILLQTRKR
ECLSDGDTSATESGDEVPLELYSTFQHTPTTITLTTGRLGNKQTDKKRKKSGDKEPQASS
ARAAFREGSRKSSRVKVNSP
Download sequence
Identical sequences G3Q929
ENSGACP00000026395 69293.ENSGACP00000026393 ENSGACP00000026393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]