SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026415 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026415
Domain Number 1 Region: 120-252
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-25
Family Pleckstrin-homology domain (PH domain) 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026415   Gene: ENSGACG00000019991   Transcript: ENSGACT00000026466
Sequence length 1346
Comment pep:known_by_projection group:BROADS1:groupVII:9281432:9306866:1 gene:ENSGACG00000019991 transcript:ENSGACT00000026466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPKIIEPLDYEAVVFQRKAQIHSDPHRDLLLCPVDDVSESQILRQRRTVVPSVPQNAERE
ARSLFAKECIKMYNTDWHVINYKYEAYSGDFRMLPSKGLKTDKLPAHVFEIDEDAKDEDT
SSLCSQRGGIMKQGWLQKANINSSLSVSMRVFKRRYFYLSQLPDGSYILNSYKDEKNCKE
TKGSIYLDSCIDVVQSPKMRRNGFELKMQDRYSHFLAADSEAEMEEWVITLRQALQSTTE
ASQDRRNGAEMLDCSLDDDAVSQGKGESLLESLGRSLQPELMKYARETDQLNKMNRSEGR
PKLFTLDPETQRLDFSGIEPDVKPFEERFGRRIVVSCHDLTFSLQGCVSEKGDGVLTNVE
PFFISLALFDVSKSCKISADFHVDLNPPCVREMLTDAAGQLSPSSDSEGGVGEGRVSEAL
MRFPTQRIFSVTTPMRYSPGGPVRKGITHCAEPSLPSVCPLQTAQKVLKAAKQTCQRLGQ
YRMPFAWAAKQVFKDAQGSLDMDGKFSPLYRQDSSKVSNDDIVKLLADIRKPEKSKLQSI
PGQLNVTIECVPPDFSNTVTSSYVPVKPFEDGCERVSVEVEEFLPDEAKYNYPFTTYKNQ
LYIRPLQLKYDNQKTFTKARNIAVCIQFRDSDEESAPSLKCIYGKPGDSLFTSSAYAAVL
HHNQSPEFYDEVKIELPVHVHEKHHILFTFYHISCESSSKASSKRREGVESLVGHSWMPL
LKDGRMQSAEVQLPVAAALPPGYLCHDTPHLSVLQQSQPDIKWVENAKTLFKVRSHVAST
IYAQDLHLHKFFQHCQLMRTTTEGSPAELIKYLKCLHAMETHVIINFLPTVLMQLFGVLT
AATKETHEIAVNSLRVIIHIVSRCHEEGLEHYLRSFVKYVFVTNNPSSGSSATTHEMLAT
AVTATLKQTADFNTSNKLLKYSWFFFETMVKSMAQYLQEGNRIKMPRAQRFPDSFHQVIQ
SLVLSIMPHITIRHMEILEEARCINLSLANFIKRCLTVMNRGFAFGLVNHYMCHFGLRDP
KVLTEMKFDFLMAVCNHEHFIPLNLPMAFGRTKMQRVQDQCLEFSLTEEYCRNHFLVGLL
LREVAEALQQGPEVRQLAVSVLKNLLIKHAMDDRYTSFKNQQARICLLYLPLLELLYQNL
KPLSAQPHTSSHGLGLNHMSLSHTRVFPLVTEPGFVLGLWIDGLSRCLNLPAPGVPAQNG
HVVRREDSRCSLFVDMGTSDSTEHMDLNTSSSSVFVLVQLNRRGSTMSSSPMPPIGRLGE
YEIKGLLLSFLHIVKTLSEDTLMAYWNKVGPQDIMNFLSLLETCLVQLRYIGKRNIGRSQ
EMCVSKLFSSDRKSQTMPVMRCNRAS
Download sequence
Identical sequences G3Q951
ENSGACP00000026415 ENSGACP00000026415 69293.ENSGACP00000026415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]