SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026443 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026443
Domain Number 1 Region: 569-1043
Classification Level Classification E-value
Superfamily Ras GEF 3.66e-128
Family Ras GEF 0.000000000000163
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 8.64e-54
Family TBP-associated factors, TAFs 0.000000309
Further Details:      
 
Domain Number 3 Region: 198-400
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-40
Family DBL homology domain (DH-domain) 0.0000000227
Further Details:      
 
Domain Number 4 Region: 418-575
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-37
Family Pleckstrin-homology domain (PH domain) 0.000000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026443   Gene: ENSGACG00000020014   Transcript: ENSGACT00000026494
Sequence length 1295
Comment pep:known_by_projection group:BROADS1:groupIX:20198840:20219835:1 gene:ENSGACG00000020014 transcript:ENSGACT00000026494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAPLQYDFFNEENGPKWRGLLVSSLEKVLNQVHPNLVSQQEALQYIEELILLLLSMLC
QAQPRTVQDVEERVQRSFPHPIDKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYMVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMFHQDE
EDISGFPLMDEEPSANEEQSYYELVRSFMSDGRQFLRTLNLLIKVFREPFTSSPMLFSLH
DVDSIFSRILDVHEVTVKLLGLIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYETYAQ
EILRSGFHEHFLSQVSKPGAAFHLQSICEGFKEAVQYVLPRLLLTPVYHCLHLFEILKQL
EEKSEEEEDKECLKQAITALLNLQSSMERTCSRSLAKRRLSESACRFYSHQMKGKHLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGPPRL
PGAGSTAEYRLKEKFFMRKVQINDKDDKEGEYRHAFEIILKDGNSVVFAAKSAEEKNGWM
AALISLQYRSTLERMLDSAMMQEEKEEQMRLPAAEVYRFAKPDSEENVVFEENVQSKSGI
PIVKAGTVLKLIERLTFHMYADPNFVRTFLTTYRSFCKPQDLLNLLMERFEIPEPRLSDL
DPMDGGEQPLSAELKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDAYLLRRLEEFIAS
VRGKAMRKWVESITKIIQRKKQVQVSMQSHSITFQSSPPPIEWHTCKPGNTEQFDLMTLH
PIEIGRQLTLLESDFYRAVQPSELVGSVWTKEDKEIHSPNLLRMIRHTTNLTLWFEKCMV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLRRHGKDLINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIRQRFFENLNPMEDLSEKDFADHLFNKSLEIEPR
NARSLPRFMKKYTCPLKSPGIRPTSARPGTMRHPTPLQNEPRKISYSRIPDSEAEGGVVS
APNSPRTPLTPPPASTTSSSTDVGSVFDSPQGPRSPVHSSKSTTPSQQCYKKHCPMQGSS
SVSSMVSFSRGSEEVPVPPPVPPRRRPDSAPTDSSPLKMMLTLDSPPAVPPRQPTCKLLP
PRYSSSLSSSSPPDSPPSLPPREPLSSPLHLLPPPQGRPRCDLQRKMPLPSPTLPHLALG
GPPVPPRHTVPKLPPKTYKREPQTPAPLLDTPPEL
Download sequence
Identical sequences G3Q979
ENSGACP00000026443 69293.ENSGACP00000026443 ENSGACP00000026443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]