SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026457 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026457
Domain Number 1 Region: 8-397
Classification Level Classification E-value
Superfamily Ras GEF 6.93e-92
Family Ras GEF 0.0005
Further Details:      
 
Domain Number 2 Region: 407-497
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000249
Family Calbindin D9K 0.063
Further Details:      
 
Domain Number 3 Region: 478-545
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026457   Gene: ENSGACG00000020027   Transcript: ENSGACT00000026508
Sequence length 607
Comment pep:known_by_projection group:BROADS1:groupVII:9434231:9454745:1 gene:ENSGACG00000020027 transcript:ENSGACT00000026508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESILSKQSATVDELVEACIQAFDGSGTLKDTSLVRMFLMMHPWYIPSTDMAKKLVLQYP
STLPFATWEILMKKLYLFKKYWISEFPAEFNLSPELADQIKDFKDLLNTEGNESQSQLID
LDSVPSYKWKRQVTQRVPSMSKKRKMSLLFDHLDSCELAEHLTYLEYKSFCKILFQDYHS
FVMHGCTVENPILERFITLFNSVSQWIQLMVLSKPTAPQRATVISHFIRVAQKLLHLQNF
NTLMAVVGGLSNSSISRLKDTQAHISAETNKVFNNLIELVTSCGNYSQYRKRFSECSGFR
FPILGVHLKDLIAVHVALPDWADKEKTRVNLAKAQQLYAILQELALIQTTPPHVDANTDL
LNLLTVSLDQYHTEEEIYQMSLHREPRKPAQNSSPASAPDPKPTMIDEWAVSVKPNADPT
IIKKHIEKMVESVFKNFDSDGDGHISREEFEAIRNNFPYLSKFGELDKNQDGKISREEMI
DYFMKASSLLNCKMGFIHTFTEATYVKPTFCEHCAGFIWGFYKQGYKCKGCQTKSLQTHF
RCKHLPVPYEKSVDSCCHNDPSPPPSPLDPSRHLLFCRRPFFAQNDISVIAEEDIETLEE
GVFDVHL
Download sequence
Identical sequences G3Q992
ENSGACP00000026457 ENSGACP00000026457 69293.ENSGACP00000026457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]