SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026509 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026509
Domain Number 1 Region: 16-182
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-49
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 171-291
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-25
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 344-520
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-22
Family Pleckstrin-homology domain (PH domain) 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026509   Gene: ENSGACG00000020065   Transcript: ENSGACT00000026560
Sequence length 523
Comment pep:known_by_projection group:BROADS1:groupIV:32303077:32307244:1 gene:ENSGACG00000020065 transcript:ENSGACT00000026560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFRDAVAKATRQNGKAVVDDRILSQILYYLPQLYQLNRDLLRELEERVAHWTDHQRLSDI
FVQKGPYLKMYSTYIRQFDNNVALLDEQCRKNAAFAAVVREFEMSPRCASLALKHYLLKP
VQRIPQYQLLLTDYLKNLPEDSEDYKDTQAALGIVKEVANHANDIMKQGDNFQKLMQIQY
SLNGQHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALMYTTPVQSSQYKLISVLSL
AGMKVSKPSQEAYQNELNIESVERSFILSAGSATERDEWLEAIAKAIDDYTKKKITFTSS
RSQEEPEGVVDTGAPLGSKAPIWIPDLRATMCMICTCEFTLTWRRHHCRACGRVVCQACS
ANKYYLEYLKNQPARVCDHCFAKLQENSDRCASTSVSPIKPGAFSFTRKQKKIPAALKEV
SANTENSSMSGYLNRSKGSKKQWKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREE
KNGPAQKMQFKLYHKNTLFYIFKADDIPTAQRWIEAFQEAMIL
Download sequence
Identical sequences G3Q9E4
ENSGACP00000026509 69293.ENSGACP00000026509 ENSGACP00000026509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]