SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026541 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026541
Domain Number 1 Region: 125-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000579
Family Ras-binding domain, RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026541   Gene: ENSGACG00000020089   Transcript: ENSGACT00000026592
Sequence length 255
Comment pep:known_by_projection group:BROADS1:groupIV:32467594:32477737:1 gene:ENSGACG00000020089 transcript:ENSGACT00000026592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWNSTMSSGYSSLEEDSEEYFFTARTSFFRKPSGKVTRPPQDVEKDRELRTEFSREEIG
QKIDQYNMLTRDLLPCRLSSDSPTGVYTGFIKVQMDLRRPVTVRGGQKGAGGGRVEEAFY
LPRGVTNTLHISSNNTVKQVIVALLNKFTVADNPAKYGLYKRYRREDQVYVCKLADDEQP
LFLRLVAGPDGDTLSFVLREQHGEVMWDAFSIPELRNFLRILDKEEAEQREAVKRRYDAY
RLRLQEALSEVRGAS
Download sequence
Identical sequences G3Q9H6
ENSGACP00000026541 ENSGACP00000026541 69293.ENSGACP00000026541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]