SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026548 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026548
Domain Number 1 Region: 40-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.12e-53
Family N-terminal domain of cbl (N-cbl) 0.00000172
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 1.81e-46
Family SH2 domain 0.00000471
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-42
Family RING finger domain, C3HC4 0.000012
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 1.5e-35
Family EF-hand modules in multidomain proteins 0.0000137
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026548
Domain Number - Region: 920-970
Classification Level Classification E-value
Superfamily UBA-like 0.000785
Family UBA domain 0.051
Further Details:      
 
Domain Number - Region: 547-562
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0128
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026548   Gene: ENSGACG00000020095   Transcript: ENSGACT00000026599
Sequence length 980
Comment pep:known_by_projection group:BROADS1:groupVII:10487838:10536241:-1 gene:ENSGACG00000020095 transcript:ENSGACT00000026599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALTGRNPGGRGPNRGKGGILGIIDAIQDAVGPPKQSAADRRTVEKTWKLMDKVVRLC
QNPRLQLKNSPPYILDILPDAYQHLRLTLGKYEENQRLSELSENEYFKVYIDSLMRKSKQ
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGHFQGDSFRITKADAAE
FWRKSFGVQTTVPWKVFRQCLHEVHLVSSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGTILRNWNFLAVTHPGYMAFLTYDEVKARLHKYIDKPGSYIFRLSCTRLGQWAIGYV
TNDSNILQTIPHNKPLFQALIDGNKEGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENNKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRNEGNRCFFMEQQSCPMLELDDEEDREDCLVMNGLANTRKHCADRQNSPMVS
PSSSPVNQYRKFHGGDLSHCVQHLGLPPVPPRLDLIQKGATHSPSASPNVSPKSSPGMSR
KQDKPLPAPPPPRRDPPPPPPPERLAPIPSESWHSWLPTSSPLTSSISSSMGKLSGSQMP
PEILFPKDTLLKPTGHCHLSGRPLSFPSAGLRTCDGMGSRGQVVGQGPVKYHKRRDHTTP
AESVRQFSGYHICSWSIVLFVSPPPCLIPSNSSRSPVVEQKWGVMERLEDHYQIPSSSVC
LSQAPICISVAGRYWLCFWLCFKLEQGHSGPAESRPKDIPSRNSYLRSQKMKHSMNSSPE
PSSGHCEPVRGLISQGTHLCPFDPNNIATDYDILLPPTGSPSPPPTPWVKHDLIQQISVI
AQRHRPSSGHEHLLSTHGAVFDMLNRAAPLPLVRRHGEHGKSFRGCLEYDQLSASQVSID
YLQAPARPPKPLPRTIPPHIKPGKPQSLHLENVDAKIAKLMGEGYSFDDVKRALMIAQHK
VDVARNILHEFALAAPRLNL
Download sequence
Identical sequences G3Q9I3
69293.ENSGACP00000026548 ENSGACP00000026548 ENSGACP00000026548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]