SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026549 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026549
Domain Number 1 Region: 386-691
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-92
Family Protein kinases, catalytic subunit 0.000000000244
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.6e-23
Family PLC-like (P variant) 0.0000622
Further Details:      
 
Domain Number 3 Region: 219-288
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.99e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 
Domain Number 4 Region: 146-214
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.98e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026549   Gene: ENSGACG00000020094   Transcript: ENSGACT00000026600
Sequence length 715
Comment pep:known_by_projection group:BROADS1:groupIV:32510967:32523662:-1 gene:ENSGACG00000020094 transcript:ENSGACT00000026600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFLRIGFSSFEMDPGLAYHEEVLSPYCAVYMKEAIDTEKGQVYKQKKPTMYPPWSTTF
DAHIHRGRIMHVMVKDRTAELKSETSVALDSLATQCKKENGKLEIWLELKPQGRLLMEAK
YYLEKSGQTEGDQECGPEREGLFALHQRRGAIKQAKVHIVKCHEFSATFFPQPTFCSVCK
EFVWGLNKQGYQCRQCNAAIHKKCIDKVLAKCTGSAINSKETMIHKERFKIDMPHRFKVH
NYKSPTFCEHCGTLLWGLAKQGLKCEECSMNVHHKCQKKVANLCGVNQKLMAEALAVIET
KQQARSNKDSDCEVVGREGPVGVGQPGAERTPSGLTAATPANKEPQGISWDGPTGLGGSI
PEAPTDEEPLYAVPKKDHLRPKFTVDDFVLHKMLGKGSFGKVFLAELKKSGEFYAVKALK
KDVVLMDDDVECTMVERRVLSLAWENPFLTHLHCTFQTKENLFFVMEYLNGGDLMFHIQF
SHKFDVHRTTFYAAEIICGLQFLHSKGIIYRDLKLDNVLLDSEGHIKIADFGMCKENMQD
ESRTATFCGTPDYIAPEILLGQKYNSSVDWWSFGVLLYEMLIGQSPFHGRNEEELFQSIR
TDNPAYPRWLTRDAKDILIKLFVREPEGRLGVKGNIRQHSFFSATDWAALEQRKVEPPFR
PTLTSPSDCSNFDKEFINEKPRLSCVDRTLINSVDQTMFKNFSFVNPGMARIAAR
Download sequence
Identical sequences G3Q9I4
ENSGACP00000026549 69293.ENSGACP00000026549 ENSGACP00000026549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]