SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026563 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026563
Domain Number 1 Region: 602-733
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.28e-36
Family Synaptotagmin-like (S variant) 0.0011
Further Details:      
 
Domain Number 2 Region: 751-887
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-26
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026563
Domain Number - Region: 5-41
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00135
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026563   Gene: ENSGACG00000020106   Transcript: ENSGACT00000026614
Sequence length 921
Comment pep:known_by_projection group:BROADS1:groupVII:10836567:10850307:1 gene:ENSGACG00000020106 transcript:ENSGACT00000026614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDLSFLTEEEQETIRAVLKRDAELKKTEEQRVRNLQKTVRDKGRLRYMTGEWFYETKQL
RHQDRIHGSEIIRASMKHSHKPLTILELSQLIPEKPRSVSSENKDFVPPALCGFLQEQHS
DESEYRHILKTPFMNQTFVIFLQVFKQRQNPFNSDIIESHSFENKDSSLMDGAVDLTQTQ
HEGLEGKENKPRKPIFLTLKTETTVCVPVFSDQGNPLHTKNTAHNASILMPMSEKRTVPS
SRDCFVEEEGPGGQQTSSAVQQGILKHLSAFSSTDSLLSCLDLQSAIGLNSPTDKWIDSK
QVRFSSMVSQSGVEWQDRKQLGENSLLDIDSFTPSEVEIKCELEDTEFSSPAVSKLILVE
QESGSVRESKISEPQDNVTIPVPPVLAFNTQNLERDIQVPLPKQSSSSPQEDKTVKISKT
NNFLEKADTEYVERPLSLRQSQTSRSKDQDDEVRRSPSKTCHPRVLPRESSSPKKSKLEG
FFLKTFPIDINPQARFVEEQQPLTPHPEDRGAYLGNLNTQQCSSSSSNSPQSKKLKKKML
TLPSLINSPTSGQRHQNDSDSTFETDLGWRRNTGSSTSNFSLSSGMASMSSVSGSVCSLY
PEDFGDIEVQGSIQFALNYIQKLQEFHIFVVHCRDLAVADNKKNCSDPYVKCYLLPDKTK
LGKRKTTIKKKTLNPTYNEILRFKIILEVFKTQSLNISVWHSNTFGRNSFLGEVDLDMSE
WDFNNTHINECALKSKVSGQNTRASPTHLMDSRGQMRVALRFLPQTPHAFTGKRTSRMET
GEVQIWVKDCKNLPPVRGIVTDPFVKCTILPDTSTKSRQKTRVVKRAANPMFNHTMVYND
VRLEHLKEACVEMTVWDHDRLNNHYIGGLRLGLGTGKSYGVEVVWMDSTTDEANLWQRML
HSDGEWVEDDLPLRMLVMVKK
Download sequence
Identical sequences G3Q9J8
ENSGACP00000026563 69293.ENSGACP00000026563 ENSGACP00000026563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]