SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026626 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026626
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily UBA-like 9.48e-25
Family UBA domain 0.00058
Further Details:      
 
Domain Number 2 Region: 164-257
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-16
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026626   Gene: ENSGACG00000020155   Transcript: ENSGACT00000026678
Sequence length 448
Comment pep:known_by_projection group:BROADS1:groupVII:12320276:12349000:1 gene:ENSGACG00000020155 transcript:ENSGACT00000026678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEQNVLQQHSQKHQQTLLNQLREVTGTTDVQLLQQALQVSNGDLAEAVAFLTEKNAKV
PQQDDTAYYQTSQVASDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESSRAFRETG
ITDEEQAISRVLEASIAENKASLKRTHTEVWSDSLNPHDRKRIDTCPVGLKNVGNTCWFS
AVIQSLFNLLEFQRLVLHYSPPARVHDLPRNQKEHRNLPFMQELRILFSLMVGSKRKYVD
PSRAVEILKDAFKSSESQQMWHQAYQNFRETTILMMTGLELFQKTNYTEALMHLIYSYQY
NKELLSKGQYRGHDDELLGHYRRECLLKVNEQAAAMFESGEEPEVTTGIGIMNDLVVPCI
PLLLIHDAERDLLAVEDMRNRWCSYLGQEMEPNLQEKLTDFLPKLLDCSAEIKSFHDPPK
LPTYSTLELSERFSRVMASVGRVPSNGR
Download sequence
Identical sequences G3Q9R1
ENSGACP00000026626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]