SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026627 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026627
Domain Number 1 Region: 164-447,550-655
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.42e-71
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0025
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily UBA-like 4.13e-24
Family UBA domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026627   Gene: ENSGACG00000020155   Transcript: ENSGACT00000026679
Sequence length 1085
Comment pep:known_by_projection group:BROADS1:groupVII:12320434:12348997:1 gene:ENSGACG00000020155 transcript:ENSGACT00000026679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEQNVLQQHSQKHQQTLLNQLREVTGTTDVQLLQQALQVSNGDLAEAVAFLTEKNAKV
PQQDDTAYYQTSQVASDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESSRAFRETG
ITDEEQAISRVLEASIAENKASLKRTHTEVWSDSLNPHDRKRIDTCPVGLKNVGNTCWFS
AVIQSLFNLLEFQRLVLHYSPPARVHDLPRNQKEHRNLPFMQELRILFSLMVGSKRKYVD
PSRAVEILKDAFKSSESQQQDVSEFTHKLLDWLEDAFQMKAEEDREGETPKNPMVELFYG
RFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSAENAARSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPSMLYMDRYMDRNRDVTRIKREEIR
RLKEHLTLLQQRLERYLSYGSGPKRFPLADVLQYAMEFASSKPVCTSPVEDIDSSAPPGG
TTGQPLSQPRQVSSQLHSSGPASLPTTAATAAQQQRVPIHKPFTQSRLPPDLPMHPAPRH
ITDEELRVLEGCLHRWRSEVENDTRDLQGSINRIHRTIELMYSDKSMMQVPYRLHAVLVH
EGQANAGHYWAYIYDPHQRCWMKYNDISVTKSSWEELVRDSFGGYRNASAYCLMYINDKK
PFLIEEEFDKETGQILSGMDKLPPDLKQHVRGDNELFDKEVQEWDALQIRKAQQEKLALV
AAAAAAAAAAAVAQQEPEYMEQPSPTNDSKHLQEDTERAISRAAAEQEGRSPEALLNAAM
MTPNMQGVIMAIGKSSSVYEKNGPETAFFKAIKLEYARLLRFAQEDTPPEKDYRLQHVIV
YLIQNQAPKKILERTLLTQFADRNLAFDERCKSIMSVARAKLDLIKPEEVNMDEYEMWHQ
AYQNFRETTILMMTGLELFQKTNYTEALMHLIYSYQYNKELLSKGQYRGHDDELLGHYRR
ECLLKVNEQAAAMFESGEEPEVTTGIGIMNDLVVPCIPLLLIHDAERDLLAVEDMRNRWC
SYLGQEMEPNLQEKLTDFLPKLLDCSAEIKSFHDPPKLPTYSTLELSERFSRVMASVGRV
PSNGR
Download sequence
Identical sequences G3Q9R2
ENSGACP00000026627 69293.ENSGACP00000026627 ENSGACP00000026627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]