SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026636 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026636
Domain Number 1 Region: 355-509
Classification Level Classification E-value
Superfamily Spectrin repeat 7.45e-30
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 1064-1184
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-24
Family Pleckstrin-homology domain (PH domain) 0.00032
Further Details:      
 
Domain Number 3 Region: 569-722
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 264-384
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 196-298
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-17
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 12-84
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 7 Region: 729-796,856-891
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000209
Family Spectrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026636
Domain Number - Region: 95-190
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0183
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026636   Gene: ENSGACG00000020162   Transcript: ENSGACT00000026688
Sequence length 1217
Comment pep:novel group:BROADS1:groupVII:12566414:12590526:1 gene:ENSGACG00000020162 transcript:ENSGACT00000026688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMARDTARDEAQKLHRKWLKHQAFMAELARNKEWLAKIEQEGQELIQEKPELRPVVQQK
LEEIRECWSDLESTTKAKARQLFENNKPEPAVKSYSDLDNQLSHLEQEPPQLEQAHHLPT
FNEQLQKFQAMESQIGDFYKDVGELGSLQGVCLPQRGLMAGDRESGEQSPVVETRIVRLI
EPLKERRRILLASKEMHQVAQDLEDEILWIQERLPLASCKDYGTNLQSVQQHVKKNQTLQ
RELTGRRARVEEVLDRAAIIASLRTPEVEFVREGAGHVRQLWEVLQLETERRCVMLDATL
QAQQYYSEAAKVESWLSGQKLHLVNEERGTDEPSTLLLLKAHLALEQTVETYAETVGMLS
QQCQRLMELGHPESEQLTKQQTHIDRLYVSLKDMVEHRKTKLEQQYWLYQLNKDVEELEK
WITERETVASSTELGHDLEDVTVLQERFTKFASETNNVGQRSMEQVNKMVNEMIDCGHSD
AATIAEWKDGLNESWADLLELMETRRQMLAASHQLHKFFTDCKEVLAQISGKMKQLPEVR
ACQANITNPATLQRLMHSFEHALQLLVAQVRQLQENAAQLRTIYAGEKAEAIMLKEMQVM
EAWKELLGSCEASRVQVTSVTDKVQFFSVVRENLMWMEGIMGQIGWDEPRDLAALEVMIK
QHQEMKAKVDGRSKTIQQCADLGKILIAAGNPASEEIQEKLDSLLAKQRDLVEKWDKHQD
KLKRKQEKFQFAQETVRAEAWLKAKEPLITSREPEGGGAQAQTDEVEQLILRHEAFRKAA
VTWKERFSSLRQLSADEKKKEEEKKTTPLSSRRMFPQTVQAHIEHKPIQTSLDLGATPAS
KRLSSTLGSYKDPKMAYAWQHLKADFMQPRINHIHKAVNPLLEASRVQREQFGDIPMADM
VGPESGLELLHGRLQRDPRGSRSDPQMDHLRREREYKLGRQTSSEQEIQARLNELPLIVR
QERYRRRLERQSSSEQEETNVYCHCREKRSTMAEIVEQAQEREAAQTRGEPYRPTSSLSA
PVTRFDGRPRARDRPKPRRRPRPKEPEETRRSRSAPATGAPTTPQPPSHTAQNEGFLYRK
KVTTSDLEAQQRSPNSKSWTNVYCVLKEGQLIFYKDARHQTTPYNDEPPVDLSNCSFDPS
MGYKKKKNVFILQMNDGNNLAFHAKDEEDLKAWTSNITNCIAEHESMGKWDKPGTSSMDP
DNSERKEKNRRQNGGRG
Download sequence
Identical sequences G3Q9S0
69293.ENSGACP00000026636 ENSGACP00000026636 ENSGACP00000026636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]