SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026644 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026644
Domain Number 1 Region: 56-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-94
Family Protein kinases, catalytic subunit 0.0000102
Further Details:      
 
Domain Number 2 Region: 661-761
Classification Level Classification E-value
Superfamily KA1-like 0.0000000000000118
Family Kinase associated domain 1, KA1 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026644
Domain Number - Region: 308-369
Classification Level Classification E-value
Superfamily UBA-like 0.00746
Family UBA domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026644   Gene: ENSGACG00000020169   Transcript: ENSGACT00000026696
Sequence length 761
Comment pep:known_by_projection group:BROADS1:groupVII:12665160:12687833:-1 gene:ENSGACG00000020169 transcript:ENSGACT00000026696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRSALPSGNDRSTGDHHVSLGASRSDKATSQSSRSLGARCRNSIASCSDEQPHIGNYR
LLKTIGKGNFAKVKLARHILTGKEVAIKIIDKTQLNPTSLQKLFREVRIMKGLNHPNIGK
LFEVIETDKTLYLIMEYASGGEVFDYLVSHGRMKEVEARAKFRQIVSAVHYCHTKKIVHR
DLKAENLLLDADANIKIADFGFSNEFTLGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVW
SLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCEGILRRFLVLNPTKRCT
LDQVMKDKWINSGYEEDDLKPHIEPIEDFSDPARIEVMVGMGFTSGEIKDSLLNQKYNEV
TATYLLLGRKGDEASEARTASSLSLARVRPSPITNGTNKHSSATGSSSSSTSSSHSKTQR
SASTYHRQRRHSDFCGPSMPVMHPKRSPTSTGERELREGRMPSRKASCSVMGSHSLPPSS
PMVSSANNPNKSEIPDRRKDMTATTNNIPGSAMTRRNTYVCTDRSGADRHSLLQNGKDNS
SLGHRMPQASPSTLSISGTGAAAASSSSDRCRLTRGSTIRSTFHGGQLRDRGPPVYSAPP
TSPTLSHHDTSPLPHARTRATSNLFSKLTSKLTRRIPNESEGIRRFAVSSCHVPWYQKAS
EPRTVGRGRDLRGGVRRDPVEVVLALREAALGCGCLVHHAGPFLLSCTHGVARGRVAFEA
EVCHLSTGTSETSNGVRYTRLWGTPLAFRDIATQISKDLEL
Download sequence
Identical sequences G3Q9S8
ENSGACP00000026644 69293.ENSGACP00000026644 ENSGACP00000026644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]