SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026721 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026721
Domain Number 1 Region: 696-1048
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.13e-52
Family Ankyrin repeat 0.0000421
Further Details:      
 
Domain Number 2 Region: 221-409,452-494,584-649
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.85e-50
Family Ankyrin repeat 0.00077
Further Details:      
 
Domain Number 3 Region: 1049-1132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.26e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 48-158
Classification Level Classification E-value
Superfamily POZ domain 9.42e-18
Family BTB/POZ domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026721   Gene: ENSGACG00000020224   Transcript: ENSGACT00000026773
Sequence length 1138
Comment pep:known_by_projection group:BROADS1:groupVII:14345404:14353827:1 gene:ENSGACG00000020224 transcript:ENSGACT00000026773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKHLALLRQEYVKMQQKLADTEKRCAVLAAQASSQGSSSPAAATAADTFISRLLVIVAD
LYRQEQYSDLKVKVAGEDLCAHKFVLAARSDAWSLANLASTFELDLSDCKSEVAMAMLRW
AYTDELELAEDDAFLIDLMKLANRFQLQLLRERCEKGVMSSVNVRNCIRFYQTAEELNAT
TLMNYCGEIIASHWDDLRKEDFSTMSAQLLFKMIKSKTEYPLHKAIMVEREDVVFLYLIE
MDSQLPGKLNELDNNGDLALDLALARKLESIATTLVNNKADVDMVDQSGWSLLHKAIQRG
DEFASIFLIRHSAQVNAATVGAVETPLHLVCSFSPKKHTVEVMTGMARIAEALLKTGANP
NMQNSKGRTPLHEAVSSGNEPVFNQLLQCKQLDLELKDHEGSTALWLALHSFDENSFAAQ
LIQRGSNPDAPDTTTENCLMQRAARAGNEAAALFLATHGAKVNHVNKLGESPLHTACRSG
LANLTAELLQQGANPNLQTQKPLPDDTVGVATQTPLHMAIAHNHPDVVSVILEQKANALH
ATNNFQIIPDFSLKDSMDQTVLGLALWTGMHNIAAQLLGSGASINDTMSNGRTLLHMAIQ
RQDSKSALFLLEHQADISVRTQEGQTALQLAISNQLPLVVDAICTRGADMSVVDDKGDPP
LWLALENGLEDIASTLVRHGCDATAWSTGPSGCLQTLLHRAVDENNEVTACFLIRSGCDV
NSTRKPGPNGEGDEEARDGQTPLHLASSWGLEDVVQCLLEFGANVNAQEAEGRAPIHVGI
SNQHNNIIQLLISHPDIRLNLRDRQGMTPFACAMTHKNNKAAEAILKREPGAAEQVDNKG
RNFLHVAVQNADIESVLFLISVQANVNSRVQDAAKLTPLHLAVQAGSEIIVRNLLLAGAK
VNELTKHRQTALHLAAQQDIATICSVLLENGVDFAAEDENGNNALHLAVMQGRLNNVRNL
LTESNIDAEAFNLRGQSPMHVLGHYGKENAAAIFELFLECMPEYPLDKCDNEGNTVLLLA
YMKGNANLCRAIVRAGARLGINNNQGINIFNYQVATKQLLFRLLDMLSKEPPWCDGSNCY
ECLAKFGVTTRKHHCRHCGRLLCHKCSIKEIPIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences G3QA05
ENSGACP00000026721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]