SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026741 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026741
Domain Number 1 Region: 160-264,307-579
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-143
Family Myotubularin-like phosphatases 0.0000000704
Further Details:      
 
Domain Number 2 Region: 1098-1163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.75e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 49-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000145
Family GRAM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026741   Gene: ENSGACG00000020239   Transcript: ENSGACT00000026793
Sequence length 1183
Comment pep:known_by_projection group:BROADS1:groupVII:14793405:14819213:1 gene:ENSGACG00000020239 transcript:ENSGACT00000026793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEEGPPSLEYIKAKDLFPQKELVKEDESLQVPFAVLQGEGVEYLGYADEAVIAISNYRL
HIKFKDSVINVPLRLIENVESRDMFQLHIICKDSKVVRCHFATFKQCQEWVKRLNRAAAH
PSRLENLFALAYHAWCLGGNVDDEDQHIHLCRPGTGDHVRQRMEMEVKRMGFDTQNVWRV
SDLNCNFKLCSSYPQKLLVPIWITDKELESVASFRSWKRIPVVVYRHQKNGAVISRCSQP
EISWWGWRNTDDEYLVTSIAKACQMDTGGRDTCGALACRQRGEAHDSSDSDFDSSLTGGS
GCDERTVPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVMFMGMANIHAIRNSFQA
LRTVCSQIPDPGNWLSALESTRWLQHLSVMLKAATLVGSAVERDGRPVLVHCSDGWDRTP
QIVALSKILLDPYYRTLEGFQVLVETEWLDYGHKFGDRCGHQENADDVSEQCPVFLQWLD
CIHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLCNNAREREMRNIYKRTCSVWSLLR
NGNKNFQNFLYIPSHDMVLQPVCHTRALQLWTAVYLPTSSPCTAVDDSMELYFPQSVTGD
ELRSLDRLPKTRSMDNLLSAFENGVALTRTSSDPNLNKHCQEGRTAPESSPTVEETSADL
SEESPSKTPEGVLGAESCEDTMEEPCLTTQPLPSLPLSPVLLGKDVALAHTPSPTPVLQH
PWPQITNPPPPLEAESPRRTGESTASPTHRSEPCLPLRCKGTEPAAAAPTSLLSGHPEGQ
EDGSPESAHLLALKPQTTLLPMEDSTETLTGDGDLPPTPPPTVSPDLTKSHLYDKEKPES
QPQVQPPEEKEDTRPDGVSGKEPVLTVAVAPFDSNQAAPRHLTSHSPFTDLSLLGSHWES
VQGLVQSACSSASHYGVSRAWQHNAYQSRRLACKLLRSQGVAAANGSQERGLQRPVRSRP
QPPSTAPPWRGISSCRRPYSSLFASSSPPPPQAPAYLDDDGLPVPMDAVQQRLRQIEAGY
KQEVEVLRQQVRQLQMRLESKQYSSPPSEPDIDYEDDITCLRESDNSNEEDSLSTHSEDR
LSEGSWDRVDRKDTEVTRWVPDHMASHCFNCDCEFWIAKRRHHCRNCGNVFCKDCCHLKL
PIPDQQLYDAVLVCNSCHDLLLVARTRDIRSQQLKKAIATASS
Download sequence
Identical sequences G3QA25
69293.ENSGACP00000026741 ENSGACP00000026741 ENSGACP00000026741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]