SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026768 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026768
Domain Number 1 Region: 381-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 227-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.43e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 3 Region: 304-380
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.66e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 4 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 5 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 6 Region: 458-534
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 7 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.1e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 8 Region: 534-610
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.35e-33
Family Ubiquitin-related 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026768   Gene: ENSGACG00000020257   Transcript: ENSGACT00000026820
Sequence length 611
Comment pep:novel group:BROADS1:groupVII:14996045:15000380:-1 gene:ENSGACG00000020257 transcript:ENSGACT00000026820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGENMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP
DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDT
IENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK
TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYNIQKEST
LHLVLRLRSGQ
Download sequence
Identical sequences G3QA52
69293.ENSGACP00000026768 ENSGACP00000026768 ENSGACP00000026768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]