SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026778 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026778
Domain Number 1 Region: 648-818
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000782
Further Details:      
 
Domain Number 2 Region: 89-288
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-40
Family DBL homology domain (DH-domain) 0.00066
Further Details:      
 
Domain Number 3 Region: 304-372,430-464
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 508-622
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000061
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026778   Gene: ENSGACG00000020265   Transcript: ENSGACT00000026830
Sequence length 867
Comment pep:known_by_projection group:BROADS1:groupVII:15140992:15195847:-1 gene:ENSGACG00000020265 transcript:ENSGACT00000026830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLGHICAVIEAHPRTSHILCISSNFNYNTDGYEGDGAEDGKSQDGSETLPFIDESPTM
SPQLCATQGPDGEAVSPTPPEGLLAGGGIEKGLEMKKLVLSGFLASEEIYINQLEALLLP
MRPLKATATTSQPVLTIQQVETIFYKIQDIFEIHKEFYDALLPNIQHWDEKVTVGHLFQK
LASQLGVYKAFVDNYKVALETAEKCSQAHVQFQKISENLKVKGPKDSKDCTTSVSMEALL
YKPIDRVTRSTLVLHDLLKHTPKDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPK
GEARQLVKDGFLVEVSESSRKLRHVFLFTDLLLCAKMKKTAVGRHQQYECKWYLPLADLT
FQTLDDSESCPSIQVLPEHEIEEMKIKISVLKSEIQKEKKAPKGQSRVERLRKKMNEQES
WLLLHSPTIPFRIHNRHGKSYQFLISSDYERSEWRESIQKLQKKADLQACVLSSVELQVL
TSSCFKLRTVHNIPVTSNKDDEETPGLYGFLHVIVHSAKGFKDSANLYCTLEVDSYGYFV
SKAKTRVFRDTSEPQWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQ
VQLDPQTVQSKNWHMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKINVVTKR
ERSKVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKEILVMLSDMDIN
AIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLMTFLPL
LDHLKRRVAEKEPINKMSLHNLATVFGPTLLRPSESESAKGLHITSASDIWSHDVMAQVQ
VLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences G3QA62
ENSGACP00000026778 ENSGACP00000026778 69293.ENSGACP00000026778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]