SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026796 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026796
Domain Number 1 Region: 73-211
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000393
Family Second domain of FERM 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026796   Gene: ENSGACG00000020278   Transcript: ENSGACT00000026848
Sequence length 416
Comment pep:known_by_projection group:BROADS1:groupVII:15441128:15445661:1 gene:ENSGACG00000020278 transcript:ENSGACT00000026848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDDCNFPPDSSDDHSQRGSVASSATLLRELQLKARHQPYKLCRQWQDLLYRFTEASEE
DISQDEPCLQYRRNVFYPKSKELQIDDEGVLRLLYEEARGNILTGRYPCDPEHWTGLGAL
SLALDEGTGLDGQQFSTTLRKKKLSSFLPAHVAMGTGGLLSTLRGKSNRQTGLEQKLMDE
YRKIIPPAGNSAEPTQLLHQYLNTCHTLPYYGCAFFFGEIDKPAQGILQRAKRKAVNVGI
CLEGVYVMDVKEKHVLLGLHFNELSWDHSYPEEQGDSHILWLEFDGDEDGTPVNKLLKIY
SKQAELMCGFIEFCVELKSVSEGGAAAEMDGEGGRSPQPAEQDGSNKNAREGRRGMLRRQ
SSVVCSRVHSLNTISYVDNGKEIKRLKPKRAASFFTRQVSAPSYSAVQVAESLEQG
Download sequence
Identical sequences G3QA80
ENSGACP00000026796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]