SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026826 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026826
Domain Number 1 Region: 612-894
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-55
Family Protein kinases, catalytic subunit 0.00001
Further Details:      
 
Domain Number 2 Region: 340-395
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026826
Domain Number - Region: 94-121
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0545
Family Glutathione S-transferase (GST), C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026826   Gene: ENSGACG00000020303   Transcript: ENSGACT00000026878
Sequence length 913
Comment pep:known_by_projection group:BROADS1:groupVII:16099627:16118171:-1 gene:ENSGACG00000020303 transcript:ENSGACT00000026878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSASAKGAKMVESDEQPERDSGGGGAAMAALHQCELIQNMIEISIPSLQGLRTKCAASN
DLTQQEIRTLEVKLMKYICKQLQCKQKVPETERPEALDSYPHLRDWLRTINLRPELIEAV
AAKLSLDALLQMSGAQVRDTMRRLGSSSEECARLSAALSCLKSVTESGGELREEGSPWLS
EPTRRDSGSLLTSDQLTGFGTPLRPHSPSPLARPSAIHSTPSTPCATFPHPRSGSVSAAP
TPEALASYCESPLTDPFPLSFSHAARLHGHTSTPPVTPPSKRRHQLKPPCTPPPPSRKVM
HLLPNITLTRSKSHESQLGNRIEDPPTNNYDYSHHRSSPQAVRRDIGLAVTHRFSTKSWL
SQTCQVCHKNMMFGVKCKHCRLKCHNKCTKEAPSCRISFLPIAKIRRTESVPSDINNPVD
RPSESPQFGTLPKAITKKDHPPVLNPLDSSSNPSSTTSSTPSSPAPFQQSNPPSATPPPN
PSPKGHRDSRFNFPVFAKAACYFQHRQQFIFPAPSAGGRCWTCCVINLNGRVLLTSLVWH
AVVSEASKSALKLNDALLQEGEEEIEDEDEDPEAEGDNEKMNVGSDGECDDLDDLPGSRG
NGWKGPISRKASQTSVYLQEWDIPYEQLDLGELIGKGRWGRVHKGRWHGEVAIRLLEIDG
NNQDHLKLFKKEVMNYRQTRHENVVLFMGACMAPPHLAIITSFCKGRTLYSVVRDTKNKL
DINKTRQIAQEIVKGMGYLHAKGIVHKDLKSKNVFHDTNKVIITDFGLFGISGVVQEGRR
ENKLKLPHGWICYLAPEIVRRMSPGNNEDRLPFSTAADVYAFGTIWYELQARDWPITNQH
VEPTIWQVGSGEGIKKVLAEISLGKEVTEILSACWAYDLRERPTFTHLADMLEKLPKLNR
RLSHPGHFWKSAE
Download sequence
Identical sequences G3QAB0
69293.ENSGACP00000026826 ENSGACP00000026826 ENSGACP00000026826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]