SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026867 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026867
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-70
Family BAR domain 0.001
Further Details:      
 
Domain Number 2 Region: 390-567
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00000293
Further Details:      
 
Domain Number 3 Region: 267-365
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000152
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026867   Gene: ENSGACG00000020331   Transcript: ENSGACT00000026919
Sequence length 795
Comment pep:known_by_projection group:BROADS1:groupVII:17088139:17105945:1 gene:ENSGACG00000020331 transcript:ENSGACT00000026919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPPLEFSDCYLDSPDFRETLKCYELELDRTSKLLKELIKDGNSVITAIRGYSLAIQKF
SKTLSAFQFDVIGDSLTDDEINITQSFQEFAGLLQEVEHDRMMLVQNASDLLIKPLEKFR
KEQIGETKEKKKKFEKESEKYHSQVDKHLNLSAKKKDSQLQEADELLEKERVSFYESSVE
YVYQIHQVQDRKKFDVVEPVLAFLHSVLTLNNLTVEMTQDFMPYKQELQLSLQNTRNNYE
STREEMEELMRRMKHPSQICKMHSCLPIEGYLYCQEKWALGVSWVKYYCKYHKDGRQLEM
VPCEQKPTTKQQFPTLLTLKSCIRRKTESTDRRFCFDVETNERNTPVTFQAILETDRKLW
MEAMDGKEPIYHSPIHNQAEMELNEVGFKFVRKCINYIETKGVTQEGVYRTVGSNIQVQK
LLNTFFDPTNPGNVDLQSSDCDVKTITSALKFYLRSLSEPLMTYSLHRDLMCAAKSDNLD
FRLSEIHSLSHKLPEKNREMVEMLIKHLVNVCSHSEENRMTPSNMAVIFGPTLMRAKEET
VAAMLDIKFQNIVVEILIEDFKKIFSYMPEDSTSPPVPPPRITPRKRQPITISKRPPRVY
QPVSHDHFQQTKNGQNDNSVLDVEVPTNPVPLQRKRPASFAPLLPREPPPRQALLPKPAN
RQERHLDSNAGRIEDARQRPDSSSPSSAANGESGVYVSRVPSFQSRRQPPKGTPANREGD
GDGPTRTKSTEKHAICRPPIRPPEPPSRSPAPQKTPSAASSEGSATSYVASKTKFFENAS
RPPGSSEHRLPSVDR
Download sequence
Identical sequences G3QAF1
ENSGACP00000026867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]