SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026871 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026871
Domain Number 1 Region: 199-336
Classification Level Classification E-value
Superfamily PH domain-like 9.35e-43
Family Third domain of FERM 0.000000272
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-35
Family Second domain of FERM 0.00000171
Further Details:      
 
Domain Number 3 Region: 489-576
Classification Level Classification E-value
Superfamily Moesin tail domain 1.02e-31
Family Moesin tail domain 0.0000122
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-26
Family First domain of FERM 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026871   Gene: ENSGACG00000020333   Transcript: ENSGACT00000026923
Sequence length 576
Comment pep:known_by_projection group:BROADS1:groupVII:17153129:17164064:-1 gene:ENSGACG00000020333 transcript:ENSGACT00000026923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFFPEDVTEELIQDATQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQAKYADYNKDVNAPGYLSGEQLLPQRVLDQHKLNKDQWEERIQVWHEEHK
SMMREESMMEYLKIAQDLEMYGVNYFNIKNKKGTELFLGVDALGLNIYEQNDKMTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYIRRRKPDTI
EVQQMKAQAREEKNHKKMERALLENEKRKREVAEKEKEKIECEKEELMARLKQIEEQTKK
AQQELEEQTQRALELELERKRAQEEAERLEADLKGAEDAKQALLQQSESQMKNQEHLATE
LADLTSKISLLEDAKKKKEEEAVQWQEKATTVQEDLEKTKEELRNKVMVAHVQEPLNEHD
ENDESSAEASAEFASDVTFKDRSEEERMTEAEKNERLQKHLLALSSELANARDESKKTVN
DMIHAENMKAGRDKYKTLRQIRSGNTKQRIDEFECM
Download sequence
Identical sequences G3QAF5
ENSGACP00000026871 69293.ENSGACP00000026871 ENSGACP00000026871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]