SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026874 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026874
Domain Number 1 Region: 26-140
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-27
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026874   Gene: ENSGACG00000020336   Transcript: ENSGACT00000026926
Sequence length 584
Comment pep:known_by_projection group:BROADS1:groupVII:17188065:17195749:-1 gene:ENSGACG00000020336 transcript:ENSGACT00000026926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDSALSSTAAAAAVRTTRSAVEMSAGDVVCTGWLIKSPPEKKLKRFAWRKRWFVLRRGR
MSGNPDVLEYYQSNNSKKPIRTIDLRECEVEMLNGQLRIKRDFHGKHLFVVKTSFRVFYL
VAKTEEEMNSWISSISQICQFASLEDAESSEEGSPHTPTSTHPSPDSSDRVSLSSHSDSS
HPLDYLFLSQCETGSVSTCRHDSFSNSEISLEQKSSEDAFKDVVPSPLYNGSLGSSSFHA
SHSPSLLLHGRCANPPFSAPCTSVALPSSSSSPVGHCAQSVFRFDKPYSPASCEATSDRQ
TPPALPPKSNHLSEQLSDDAAHRPRATGAQHFSNHAAGFLRRTSLTSLDHFRIANAHSRA
MTNRRQSLNLPCVNTAQVQSFQDESYVPMTSPTPSVSGIDGDGYIPMSPRTFAFSSTNCN
GESPATLGPLTCLPGDLAPPPVHRHLKPRLRRTRPPPLDLRGLSTITECPTHLLLSTAMN
ESCFSVNCVPPERRMENENNPKDEGTNCTAMESRHDAMAQPSTRRSNLDYLSLDFNSASP
SPVQTQKPYLSDEYRVDYVQVDEKKTQALQSTKMEWSDVRQSKT
Download sequence
Identical sequences G3QAF8
69293.ENSGACP00000026874 ENSGACP00000026874 ENSGACP00000026874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]