SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026887 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026887
Domain Number 1 Region: 202-260
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000131
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026887   Gene: ENSGACG00000020345   Transcript: ENSGACT00000026939
Sequence length 401
Comment pep:novel group:BROADS1:groupVII:17292356:17297791:1 gene:ENSGACG00000020345 transcript:ENSGACT00000026939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAATLSTTTSKLNVLVNKLHEYLAHSTVEDDNGAPSSEEADGLINRSFSGENSTCRAAP
VTGGHTKYSRRKPSVVIKHSGLDESGDSNASEDVDLPVSVNGRLDITRLPKGTVLVRPEP
VDSGRDDFRGPEFRSRKSGVLRKEFSRRRVVDHMEIVSCTACGRQVNHFQKDSFFRHPVL
KVLICKSCYKYYSSDDISKDGDGMDEQCRWCAEGGNLICCDFCSNAFCKKCILRNLGRKE
LSGILESKWYCYVCSPETLFDLVVACDNVLENMEHLWYQQPRKNRVEPEKSELYTMLPHS
PQNIPLDKWDHTGMDGNVVFNYNTLQISKDVTKKAKHLVDSTNILNRTFVNFIHTVTADQ
QAPTVRNLYLNSFLTVVKGLRKSLTALEDSLKEEFSDLDVM
Download sequence
Identical sequences G3QAH1
ENSGACP00000026887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]