SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026933 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026933
Domain Number 1 Region: 195-579
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-161
Family Myotubularin-like phosphatases 0.00000000000174
Further Details:      
 
Domain Number 2 Region: 70-192
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-35
Family GRAM domain 0.00000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026933   Gene: ENSGACG00000020375   Transcript: ENSGACT00000026985
Sequence length 638
Comment pep:known_by_projection group:BROADS1:groupVII:17690575:17695081:1 gene:ENSGACG00000020375 transcript:ENSGACT00000026985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSGSVDSLGSKRSSSRQPSVDSLSSTSTSRSDRSAQAKPLFAMSSESVATSAELSPEF
RVFRDSGKEEPQLLPNEAVQDMAQDVTYFCPFIGALSGTVLVTNYRLFFRCMDREPAFVL
DLPLGVVSRVEKIGGASNRGDVSYGLVCKDMRNLRFAHKQMEDTLRKSIFEVLVKFAFPV
SNGLQIYAFEYGQVFPENGWKVYDALSEYKRQGIPNESWRITKVNDHYEVCDTYPSTLAV
PVNIPDEELKRVAAFRAKGRIPVLSWIHPESQATVTRCSQPMVGVNGKRSKEDEKYLQAI
MDANAQSHKLFIFDARPSVNAAANKMKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKL
KDVVYPNIEDSHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTGQ
LTSLAMLMLDGYYRTIRGFEVLLEKEWLSFGHRFQLRLGHGDKNHTDADRSPVFIQFIDC
VWQLTRQFPAAFEFNEYFLVTILDHLYSCLFGTFLCNSEQQRLKEEIPKRTVSLWSYVNS
QLEEFTNPMYVNYSNHVLFPVVSLRHLELWVGYYIRWNPRMRPQEPVHQRHKELLAKRAE
LQKRVDELQREVTNRSASSSSERTGSPTRSITPVQTFV
Download sequence
Identical sequences G3QAL7
69293.ENSGACP00000026933 ENSGACP00000026933 ENSGACP00000026933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]