SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026945 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026945
Domain Number 1 Region: 510-659
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-38
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.39e-17
Family SAM (sterile alpha motif) domain 0.0035
Further Details:      
 
Domain Number 3 Region: 223-301
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000116
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026945   Gene: ENSGACG00000020385   Transcript: ENSGACT00000026997
Sequence length 952
Comment pep:known_by_projection group:BROADS1:groupVII:17795411:17818111:1 gene:ENSGACG00000020385 transcript:ENSGACT00000026997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVMEPVSKWSSSQVVDWMKGLDDCLQQYIKTFEREKVGGDKLLRITHQELEDLGVSRI
GHQELVLEAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRATHKL
PNDFLTSVVDLIAAAKSLLAWLDRSPFAAVADYSVTRNNVIQLCLELTTIVQQDCSVYET
ENKILHVCKTLSEVCDHIISLSSDPMETRAAHLEDVPLADIWSTEGLGMYIKSTYDGLHV
ITGTTEGSLADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNLLRGDPAGVTLTLKKRPQST
LTSTPALLKNMRWKPLALQPIFPQSPSSSVATPTSTLSTPSRRSSCALQDLYIPPPPAEP
YTPRDDKSNLSGDDPQSDAQVAEGSESPNSYLDQECRRQFPLVEEDAILYCYEYDQNQEV
SSVRRGSTPTYGRLRPISMPVEYNWVGDNEDLAKLSQRRTRENSLLRFASEDKSPGEDFL
LGRSLSQNRRKSERRASPTHYTLVPALQMEVSLSTSSSDSASLYHVFERSSLMSRSKKKS
KAGSPMSSISKRRISCRDLGQGDCEGWLWKKKDAKTYFSQKWKKYWFILKDTCLYWYMNE
EDEKAEGFVSLPEFKIDRATECRRKYAFKACHPKIKTFYFAAENVDDMSRWLSRLSMAVA
GYSEQEKIQPDQDYWSESDHEDMEMPPMTKQDSPPPPYDTYPRASSVSPVSPYLQPKRGH
LSSSDTFQSRSSHDDFHSKPQDGSSNNGISPGQKTSGHRNSWHDQMENNTRMHYLQTLPA
EDNLLSEDRDQLTMEYRRQSTLPAQRSQLLEQYRALPLPLRSSIDSDAGGKPRSFTLPRD
SGLHAILAASAAASDQREPHHYQLDRARGSGQTHSIAVGISLTDKSQGRDCRMQADSLGD
LYRALEQSSLSTSSDHRSANRLEYKRSFVRRVNDPLLDDKLHRLRILHSSLK
Download sequence
Identical sequences G3QAM9
69293.ENSGACP00000026945 ENSGACP00000026945 ENSGACP00000026945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]