SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026957 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026957
Domain Number 1 Region: 268-455,537-584
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.36e-42
Family Phospholipase D 0.037
Further Details:      
 
Domain Number 2 Region: 600-695,724-798
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.36e-25
Family Nuclease 0.047
Further Details:      
 
Domain Number 3 Region: 49-115,143-178
Classification Level Classification E-value
Superfamily PX domain 0.00000000000301
Family PX domain 0.0053
Further Details:      
 
Domain Number 4 Region: 191-294
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000998
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026957   Gene: ENSGACG00000020393   Transcript: ENSGACT00000027009
Sequence length 935
Comment pep:known_by_projection group:BROADS1:groupVII:17899767:17908142:1 gene:ENSGACG00000020393 transcript:ENSGACT00000027009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFLVVHHLSEVQDEGIPFLMPGIPITCRVDNTEKYTTRSKRIESHIVMCLISITSLQVHV
GTLYTVQLTHGHFHWSVKRKYKHFQELHRDLYKHKMMRHLLPLGRSVHQSIFKGQAAAES
HVRRDAEPPRNGTHQKDLQQNGIKQTNQKYLEEYLNGLLENTFCRNDHSMLEFLSVGALS
FVTDLGPKGLEGPIFKRSGGHRIQGLNCIGHHQLCFRWSRRWLVVKDSFLMYMNRDNGCI
NFVLLLDPEFKVKVGRAYTDTRYGVCIENFTRSLIIRCSSYRQTHWWSHEINRLTDTCDF
LKVQRFDGFAPPREHTLTKWYVNGSGYFADLADALEQAKEEIFITDWWLSPEVFLKRPAT
DNYWRLDEILKRKAEQGVKVCVLLYKEMEMALGINSEHSKRTLMNMHPNIKVMRHPDHVA
SVIFMWAHHEKTVAIDQTVAFVGGIDLAFGRWDDSQYRLTDLGVSQTANPTRDALDNGMS
GGPEPSEPDKEEKKPLDDLTGNSKLWLGKDYSNFIRKDWVQLDKPFEDNIDRTQVPRMPW
RDLSAAVHGKAARDVARHFIQRWNFTKIFKNKYKDEFYPYLLPKSHCTADSLSFTVPGSS
KAKVQVLRSADRWSTGTNENSILNAYIHTIENSEHYIYIENQFFISCADGGKTIYNGIGD
AIVKRILRAHREQKKYRVFVVVPLLPGFEGDISLGGGNAIQAILHFTYRTMCRGEHSILS
RLREAVEDLWTEYITLCGLRKHSLLSQSLVTELIYVHSKTLIADDRCYIIGSANINDRSM
LGSRDSEMAVFVEDEDRVLSVMGGQEYQAGPLTLALRKECFSVLVGASSDPSVNVDDPIS
DEFFFLGWNASAKLNVNIYEKVFKCLPTNSVHNMRQLKEYASEERLCDTDPEQAKEELKA
VRGLLVHFPLRFLCEENLLPPLSTKEGMAPVGLWT
Download sequence
Identical sequences G3QAP1
ENSGACP00000026957 69293.ENSGACP00000026957 ENSGACP00000026957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]