SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026972 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026972
Domain Number 1 Region: 18-280
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.9e-90
Family Calponin-homology domain, CH-domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 2212-2325
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-34
Family Pleckstrin-homology domain (PH domain) 0.0000122
Further Details:      
 
Domain Number 3 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-33
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 908-1063
Classification Level Classification E-value
Superfamily Spectrin repeat 2.96e-30
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1014-1169
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-29
Family Spectrin repeat 0.0000255
Further Details:      
 
Domain Number 6 Region: 607-736
Classification Level Classification E-value
Superfamily Spectrin repeat 8.4e-27
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 7 Region: 1232-1380
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-26
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 8 Region: 1669-1806
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-26
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 1863-2019
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 10 Region: 1454-1591
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-24
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 11 Region: 702-816
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-24
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 430-529
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-20
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 13 Region: 533-641
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-19
Family Spectrin repeat 0.00076
Further Details:      
 
Domain Number 14 Region: 1598-1701
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 1388-1487
Classification Level Classification E-value
Superfamily Spectrin repeat 6.91e-18
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 16 Region: 822-923
Classification Level Classification E-value
Superfamily Spectrin repeat 1.55e-16
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 17 Region: 2006-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000589
Family Spectrin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026972
Domain Number - Region: 1176-1241
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0863
Family Spectrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026972   Gene: ENSGACG00000020404   Transcript: ENSGACT00000027024
Sequence length 2381
Comment pep:known_by_projection group:BROADS1:groupVII:18025434:18055295:1 gene:ENSGACG00000020404 transcript:ENSGACT00000027024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSTLSPTDFDSLEIQQQYNDINNRWDLAAETDWDNENSSARLFERSRIKALADEREAVQ
KKTFTKWVNSHLGRVTSRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENV
DKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAK
DALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFSAIVHKHRPDVIEFDNLKRSNAHYNLQN
AFNVAEKDLGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDY
AIEADQLIEKYESLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKF
TEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIR
QEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDIGAYWE
RVAAVEAVAKEMEAERYHDVRRVIARRDNVLRLWEYLKELLAARRERLNAHRDLQRLFEE
MRYIMDWMADMKGRLQSQDCGKHLHDVLDLLQKHTLVEADISAQAERIKAVQGAAQRFTS
YEQAYKPCEPGLVSEKVDLLGQAYEELGQLAGKRRVRLEESRRLWQFQWDVGEEAAWIRE
QEQILASGDCGRDLTSALHLLSKHEAFRDEMAARYGPLSNSIAAGEALVQEGHFGAPEVV
ERIQDINAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETFRQVSSQEVGHDE
FSTQTIARKQREVEEEIQSHRPGIDSLHEQVQALPQAYIHFPEVDGRLPDIERRYEELES
LSVARRQALEGALALYRMFSEAGACQLWVEEKEQWLHGMEIPTKLEDLEVVQQRFETLEP
EMNNLGTRVTDVNQVAEQLLSSDNCNKDQIHQTRDQLHNRWKEFEQLADQKKVALESALN
IQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLR
NEAEKLALEHPDQAGEIQGHLEEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQS
WLSRTQTAVASEDIPTSVPEAESLLAQHESIKNEVDNYKEDYEKMRAVGEEVTQGQTDAQ
HMFLAQRLQALDTGWHELRRMWENRHNLLAQAFDFQTFLRDAKQAEAFLNNQEYVLSHTE
MPTSLQGAEEAIKKHDDFLTTTEASEEKIIGVVEAGRRLIHDSNANSDKIEEKVDSIQER
HVKNKEAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKH
QAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQTLEDLQRQWEELEGTTRTKAQCL
FDANRAELFTQSCSALDVWLKNLEGQLHSDDYGKDLTSVNILLQKHQMLEHQMEVREKEV
QSLQTQALALSQEDAGIAEVDGQQRRVTDNFSNLQDPLTLRRQRLLASKEAHQFNRDLED
EILWVKERMPLADSTDHGKDLPTVQLLIKKNQTLQKEIQGHQPRIDDIHRRGQTQSQVDG
ERQSVLEERLVELRDLWDQLIAETDKRHARLMEANRAQQFYADAAEAEAWMGEQELHMMS
EEKAKDEQSALVMVKKHQTLEQALEDYAQTIHQLANSSRTMVNGEHPERDSERITLRQAQ
VDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTM
LRDKFREFARDTSTIGQERVDGVNGLADDLIESGHPENASVAEWKDGLNEAWADLLELID
TRTQMLAASYELHRFHQDAMEVLGRVKEKREGLPSDLGRDLNTVQHLHRQHNTFENDIQA
LSGQVNQVQDDAARLQKAYAGEKADDINRSEQAVTSAWEGLLEAGQARRLLLLDTVEKFR
FLNMVRDLMLWMDSVNLQIDAHDSPRDVSSAGLVIANHQDIKSEIETWADSFTACNEMGN
SLINNNHYAADEIREKLAQVQEGREKINNKWQDKMDHLQIVLEVLQFGRDACVAESWLAG
QEPLVRAAELGSNVDEVESLIKRHEAFEKLATAWEDRFVLLEKLTTLEEQEMQRRREEEE
RARRPPTPPLAEVAQSETESQVHDSLARTSLDQTTLNQSVSVNGVHSDNDTSQPRVPLLF
KVKVQKVNVGSRPLMSRPKPQGSESESVNGPGRDSGLASSRLDPSATLPGRGGAEPDTTE
GMLCRKQEMESHNKKAATRSWQNVYCVLRKGSLGFYKDGKSASGGIPYHGEVPISLGEAV
CEVAHDYKKRKFVFKLRLGDGKEYLFQAKDEAEMSSWIRSIISSIPTGAADSPVGPRALS
RAMTMPPISSGSGEAGGVTMRNKDGKDKDREKRFSFFGKKK
Download sequence
Identical sequences G3QAQ6
69293.ENSGACP00000026972 ENSGACP00000026972 ENSGACP00000026972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]