SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026973 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026973
Domain Number 1 Region: 316-386
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000332
Family PHD domain 0.011
Further Details:      
 
Domain Number 2 Region: 206-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000398
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 270-331
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000036
Family PHD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026973   Gene: ENSGACG00000020405   Transcript: ENSGACT00000027025
Sequence length 400
Comment pep:known_by_projection group:BROADS1:groupVII:18060067:18065841:1 gene:ENSGACG00000020405 transcript:ENSGACT00000027025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVENVVKLLGEQYYRDAMEQCHNYNARLCAERSVRMPFLDSQTGVAQSNCYIWMEKR
HRGPGMAPGQLYTYPSRRWRKKRRSHPQEDPRLIFPSVKSDLDVGLKKDALLSADGSSLE
ALLKGESMDKRTTTELRGSEEDSNLSESTGGLNPAARIRKRVVEPDDFLDDEDYEEETPK
RRGKGKGKGRGVGSNKKKPDTAAVEDREKPYACDICGKRYKNRPGLSYHYAHSHLAEEEG
EEKEEMEINEPALPLPDEPKTTKKGPDGIALPNKYCDFCLGDSKTNLKTGQSEELVSCSD
CGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNMCGTSENDDQLLFCDDCDRGYHMYCL
NPPMAEPPEVWQQGSWSCHLCLELLKDKASIYQKQNAPPS
Download sequence
Identical sequences G3QAQ7
ENSGACP00000026973 69293.ENSGACP00000026973 ENSGACP00000026973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]