SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026989 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026989
Domain Number 1 Region: 1105-1220
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-21
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 2 Region: 39-134
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.56e-21
Family FHA domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026989   Gene: ENSGACG00000020415   Transcript: ENSGACT00000027041
Sequence length 1231
Comment pep:known_by_projection group:BROADS1:groupVII:18180559:18199729:1 gene:ENSGACG00000020415 transcript:ENSGACT00000027041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVGRNKVEQGRQVHQVLQSTPLDLLEKGKSLKVQAERPHLVSLGSGRLSTAITLLPLL
SGRTTLGSGETDIPLQGHGIADHHCYIENQADSITLYPCGNQCCVDGLPITKPFRLTQGC
MLCFGQSVFFRFNHPEEALRMKSMLPGGSQGSSTTRTHPTGSLSVLNGNHQAFSSNGDSE
ISNMTKNLQDSLLLKAGSGKRLIPQPSPPNMPNGRNGSAAEDSIYENSSSFLGHNLGSET
PPVPVRSAHTGHTPVPHPRISLSVASSGTSGAWWVKESPKLLRSAKAEATSSPSPPNGGS
GQGPVKRSPTAPSSPRVGGTILQKRPPSPLRDQHLHNVEVPQRLRTPEPIGSTSLRELPP
LSPYMSRRAPPGSQGHLKITATSKEEASKGMYSQGVSSPSGLEKESSGKQSRSGPGGAIL
SGLGSLSGLSPLASPRSNRKTSCMNMKGSTSKEQSLVKPHTRERKNSISEISDNEDELLE
YHRWQREERMREQEMEKLERQRLETILNLCSGFNQQDSAEVGRSGLLGGARGARSDSAGG
MSLEGVDRPQRLRENDEETQREESSSTESTHQEFEELSAGAEQVCLEEERSRILARVDDL
KHRVSELELQLQETKTGRVEMEQALLQAERRAEEQQVEAENEMISQLQLKLSQLDKATQR
EKDKTSEALESGTKQFEELEFCQLEEESSLEEKKETQSLQLHQERAEYHCSVAKRKEKMT
AIEAQAKQLGLQAAQDCERMAKDRTMTLQQLHKEQERLCALEKRYHTVTGGRSFPKPHSS
MKESQPELSRNAMSPINLERWYQDIMAAGEPQSCPPPLPAKSLSTRRHSQLLRSKSDAGV
AQATSCTLPSSSGAAHEKHASTKVSRSFRQGLQLMLREMSHTLDTDSRRRLALQSKGTAH
LIHLRNMLWMWLQSTSSNELTPSAEGAVTVPAPTDLSPTVHRSILHHQAPPSGNQAYDTL
SLESSDSMETSVSTGNSACTPERCCSASGFEAQRIEEMEKMLKEAQQEKARLMENREREV
QARRQMLEEERRRREEAERRLHDETAHRLRLVEEEVKMREKHFSQARPMTRYLPNRKEEF
DLRAHVESSGHSVDTCPFVILTEKMCKGHLVKMGGKIKSWKKRWFVFDRIKRNFCYYADK
HETKLKGLIYFQAIEEVYYDHLRSATKVTLFLHFLPFIHICMMFKSPNPSLTFCVKTHDR
LYYVVAPSAEAMRIWMDVIVTGAEGYTQFMS
Download sequence
Identical sequences G3QAS3
ENSGACP00000026989 69293.ENSGACP00000026989 ENSGACP00000026989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]