SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026998 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026998
Domain Number 1 Region: 376-390,422-633
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 7.31e-35
Family Cofactor-dependent phosphoglycerate mutase 0.019
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily UBA-like 1.66e-16
Family UBA domain 0.00049
Further Details:      
 
Domain Number 3 Region: 246-309
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000177
Family SH3-domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026998
Domain Number - Region: 79-138
Classification Level Classification E-value
Superfamily LigT-like 0.00445
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026998   Gene: ENSGACG00000020421   Transcript: ENSGACT00000027050
Sequence length 641
Comment pep:known_by_projection group:BROADS1:groupVII:18349455:18364730:-1 gene:ENSGACG00000020421 transcript:ENSGACT00000027050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKEELYAKVTPRRQRQSRPSTVKHGSTLDVLLSMGFPKTRALKALVSTGGKNVQAACD
WLFSHVDDPFLDDPLPREYVLYLRPSGPLLQQLSHFWQQSRVSCGKNKAHNIFPHITLCL
FFMCADDKVEALTEALVTTVAKWKGRIPMPLPLELYTSSTFIGLFVEEQMAEVLKSFASD
FATEATAKADVHVEPHKKQLHVTLAYHFQTSHLPTLEKLAKSVDVSSGCDWLAVLLSRDI
RFANHETLQVMYPYVPQNEDELELMPDFIFMAPAEQSSASEGWVYGTSLATGLSGLLPEN
YVNRADESDTWVLHGSHSMTTCTSPSNYGSTVAGSLFDGQLGDSLLDTFTASPGHAGQCP
PMQVPGPTSQSSPSKMRLFVCRHGERMDVVFGKHWITQCFDAKGRYIRSNLNMPSSLPAR
SGGHRDYDKDCPITVFGSTQARLVGEALSESNTRVDFVYCSPSLRCVQTAQHILQGLQLE
GKTKIRVEPGLFEWTKWVSGTCLPVWIPPAELAAANMSVDTTYRPHFPISKLAISETYDN
YISRSFQVTREILVESKNLGNTVLIVAHASSLEACTRQIQGLSPQSAKDFVQVVRKIPYL
GFCACEEMGETGVWQLVDPPILPLTHGPNHSFNWREMLMQD
Download sequence
Identical sequences G3QAT2
69293.ENSGACP00000026998 ENSGACP00000026998 ENSGACP00000026998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]