SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027039 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027039
Domain Number 1 Region: 517-705
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.000000317
Further Details:      
 
Domain Number 2 Region: 713-837
Classification Level Classification E-value
Superfamily PH domain-like 4.59e-33
Family Pleckstrin-homology domain (PH domain) 0.0000119
Further Details:      
 
Domain Number 3 Region: 187-327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000601
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027039
Domain Number - Region: 286-425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00592
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027039   Gene: ENSGACG00000020447   Transcript: ENSGACT00000027091
Sequence length 839
Comment pep:known_by_projection group:BROADS1:groupVII:18679097:18687043:1 gene:ENSGACG00000020447 transcript:ENSGACT00000027091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESNPLRGFPRLRRAATSFPGNLHLVLVLRPTGLFSSAPSPSSSTDLGFRFSQDDFLLK
MPVVMLRSVGDLLRYIDENHLTTDFTAKVEYCQSDWVVLRTVPSSVPLTVKEMAQLLPAL
GSEFLRRNSRRKPSPRVPSALPHAPIRTEEGFLFQDDIRSVQKEGRLLLVNLETVKASKR
DAEEERDLKSDMDTVQRLLAQLRDMEEAFDGFFEKHHLKMQQYLQLLHYEMSFQQMEEVL
ERIGKQEIDIASVGTTVVQTSQLLTDLEMLDTHAQEEMARAQVVILHGHQLAASHHYALA
LIVQRCNELRHHCDIITAAIRTKRASLTRARDLLLRLEGALRWCDDGAYLLASQMVDKFQ
TREGAQEALQYLSCHQERAPSALKNSQDILSLEFEGILTPQLQSQIATVTEKLSAVQSMI
RNREQCRRKLADVQVRPIQLVAPRPEPDQASQRCKSPLFSPKHAGVDFNVLNSKFSFDLL
PGKRAARRNNNQRKIEVMHDFQGNRSCLYGSTTETDSEAETFTSHIMKELIATERIYVDE
LLSVLLGYRAEMEDPSVSNLLPSALRSQKDVLFGNMPEIYQFHSRIFLQDLQGCLETPER
AGTCFLQRKVKFQVYERYCQNKPCSELLWRQCSDSPFFKECQKKLDHKLGLDSYLLKPVQ
RLTKYQLLLKELLKHCTEERYRCELQQALDSMLELLKSVNDSMHQIAITGYQGDLSQLGR
VVMQGGFSVWISHKRAAVRMKELARFKPMQRHLFLYDLALLFCKRRDEDTHERTPFYSFK
SCLRMSAVGITENVKGDVKKFEIWYSGREVVYIVQASTLEVKVAWLTEIRRILTNQQKL
Download sequence
Identical sequences G3QAX3
ENSGACP00000027039 ENSGACP00000027039 69293.ENSGACP00000027039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]