SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027044 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027044
Domain Number 1 Region: 173-300
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-16
Family Pleckstrin-homology domain (PH domain) 0.053
Further Details:      
 
Domain Number 2 Region: 433-525
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000466
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027044   Gene: ENSGACG00000020451   Transcript: ENSGACT00000027096
Sequence length 664
Comment pep:known_by_projection group:BROADS1:groupVII:18717956:18728613:-1 gene:ENSGACG00000020451 transcript:ENSGACT00000027096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKHQSVVMERLVSELGSLLKLLDHETVSPATTDKMASIRNILDSMQLSVNGSDVYINS
CLYGNGTSFVESLFEDFADCDLHMLSASPEEHKEHTEEEETPQTPNDTPPPLPTTPLPDD
YYEEAVPLDPGSAPQYFTTNMNSSVLNSVEDAYYEDADDNYPITRINGPPKNSYNDSDAL
SSSYESYEEEEDEEAKGRQQAEESPEEPVKDCRICAFLLRKKRFGQWAKQLVVVRDQKLQ
CYKSIKESTPHTELPLNLCNVIYVPKEGRKKRHELRFSLPGGEVLVLAVQSKEQAQRWLK
KQVVQDVGSQCSNTEGSTSPIIQRKLELDKVLQCDRQASDSDSGPTAENQSTALGPGRDT
SDSLSRGKRGTFSELTGSMSRAAGKKINRIITFSKRKPPLPGEPSSAPGHHDNPRCDAIW
MIVSLYVDCLCRKEHWCVVRGGNLYMQKEPGDRPPVIVVPLKGAEVATGGLGPKHPFSFC
ILQEGSELASLEATCSEDLGRWLGVLFAETGSATLPEELHYDYIDVDTLTDIRHAARHSF
LWATTTATSSCSASTDSRTYDEVYESVEADVESRAGQVRRHASFSSRDSEKTEQQAAVKR
HASNVNPYARYGKTRAEEDARRYLSQKEGLEKQKEELRHALISLRMEKKEVKEEMKSAAG
QKRI
Download sequence
Identical sequences G3QAX8
ENSGACP00000027044 ENSGACP00000027044 69293.ENSGACP00000027044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]