SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027050 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027050
Domain Number 1 Region: 125-303
Classification Level Classification E-value
Superfamily HAD-like 2.9e-27
Family NLI interacting factor-like phosphatase 0.017
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-18
Family Ubiquitin-related 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027050   Gene: ENSGACG00000020456   Transcript: ENSGACT00000027102
Sequence length 316
Comment pep:known_by_projection group:BROADS1:groupVII:18801795:18806173:-1 gene:ENSGACG00000020456 transcript:ENSGACT00000027102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSVIIKWGGQEYSISSLSEEDTVMDLKQSIKTLTGVLPERQKLLGLKVKGKPAEDVVK
LGALKLKPNTKIMMMGTREESLEEVLAPPPENDDVVNDFDIEEEVIEVENREENLAKIAR
RVKDYKVEEMNPPREGKGLLVLDVDYTLFDHKSCAETGQELMRPYLHEFLTSAYEDYDIV
IWSATSMKWIDAKMKELGVTDNPNYKITFMLDSAAMITVHTPKRGVVEVKPLGVIWGKYE
EFYNRRNTIMFDDIGRNFLMNPQNGLKPFMKAHLNREKDRELYKLAQYLKEIAKLDDLSG
LNHKHWERYLSKRQHH
Download sequence
Identical sequences G3QAY4
ENSGACP00000027050 ENSGACP00000027050 69293.ENSGACP00000027050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]