SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027162 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027162
Domain Number 1 Region: 42-144
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.65e-24
Family Ubiquitin-related 0.00000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027162   Gene: ENSGACG00000020544   Transcript: ENSGACT00000027214
Sequence length 155
Comment pep:known_by_projection group:BROADS1:groupVII:19808277:19812190:-1 gene:ENSGACG00000020544 transcript:ENSGACT00000027214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPLRGPSIFNPIRLLKYLGSFKMRNELLKSGPPDLLKAVNWKQINLRLILVSGKTKEFLF
SPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGAPQLALKLPLGR
TTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Download sequence
Identical sequences G3QB96
ENSGACP00000027162 ENSGACP00000027162 69293.ENSGACP00000027162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]