SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027177 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027177
Domain Number 1 Region: 2254-2553
Classification Level Classification E-value
Superfamily BEACH domain 5.49e-117
Family BEACH domain 0.000000000113
Further Details:      
 
Domain Number 2 Region: 200-385
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.56e-32
Family Clostridium neurotoxins, the second last domain 0.03
Further Details:      
 
Domain Number 3 Region: 2670-2923
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.78e-31
Family WD40-repeat 0.0062
Further Details:      
 
Domain Number 4 Region: 2142-2249
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-28
Family PreBEACH PH-like domain 0.00000417
Further Details:      
 
Domain Number 5 Region: 479-584,665-961
Classification Level Classification E-value
Superfamily ARM repeat 2.11e-17
Family Plakophilin 1 helical region 0.074
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027177
Domain Number - Region: 78-212,475-533
Classification Level Classification E-value
Superfamily ARM repeat 0.084
Family Mo25 protein 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027177   Gene: ENSGACG00000020556   Transcript: ENSGACT00000027229
Sequence length 2936
Comment pep:known_by_projection group:BROADS1:groupVII:20054776:20129917:1 gene:ENSGACG00000020556 transcript:ENSGACT00000027229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSHPPPPGSSSAQPPQQQQQLAAGAGSGATGERMVSSAGSMVLPAGVINPAVPIRNIQM
KFAVLVGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQEAESIGCMVELLSHCEVTC
QAEIWSMFTAILRKSVRNLQTSTEVGLIQQVLVKMSTVDDMIADLLVDMLGVMASYSITV
KELKMLFSMLRGDNGIWPRHAIKLLSVLNQMPQRHGPDTFFNFPGRSAAAIALPPIAKWP
YQNGFTINTWFRQDPLNNINVDKDKPYLYCFRTSKGIGYSAHFVGNCLIVTSLKSKGKGF
QHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLG
SSETADANRVFCGQLGAIYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQ
VLYDGKLASSISFTYNAKATDAQLCLESSPRENASIFVHSPHALMLQDVKAIVTHSIHSA
IHSIGGIQVLFPLFAQLDYKQLNDCSVDTTVCATLLAFLVELLKSSVAMQEQMLGGKGFL
VIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLPHGAPLLKQLCDHVLFNAAIWIHTPAKV
WSQLSLYTYLSSEFIGTATIYTTIRRVGTVLQLMHTLKYYYWAINPLECSGITPKGLDGP
RPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALM
SEHPASMIPAFDQRNGIRVICKLLASKSESIRVQALKVLGYFLKHLGHKRKVEIMHTHSL
FTLLGERLMMHTNTVSVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVAT
LLKSSSPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNPEEQ
KITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEE
ENMKKGKKGCVSTISGLSATPAAVVNGNLEIDDNSQTQTPESEAEYSEGGGGDSRNLLAE
GVVKRPNGEALTPGEQSAVPGVRVEVHDLLVDIKAEKVEATEVKLDDLDLSPEGLSGGVG
GGGVGGIENGPLVEVDSLLDSAYCAVVQKLNGNLAPKVGLEDDGNMGPLITLADEKDSVP
SNNGFLFPKVDEKLLPALAATDPLVLPSADQPTASGSVPAHSSTSASDDLSLLAHMTSCG
SNLTQTQSHSSGDLPEDGPFEIQSPLADISSIAEAESRAQIQETLRSDFPEGEGTSGPEG
EAAGLKTGGDTASTTSDTERSDDGKDKDTKKIQTTATTQALHGRTAAQLERDLRVDLGFR
GMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMD
FVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSSSKTELENIEATQGMSS
ETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQ
RQRDRSCKSSLTSSKSQDSLHSASTTGKVPHTQIQCTSLSLHDPDRLLQDVDINRLRAVV
FRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQREIGRSTSLSGRSIRHEINSPTST
VIVVYVVAEHPSTAFSDRDKQTPTPVDDSPRVGLPHTDSGIGEEGHVAGSLNGSEMGLGL
GLGLVGDLLCSLSDVRRSQESLLDSPHNPNSSQAPPSSISSISQTSKGINVKEILKSLVA
APVDGGDSGQDSGPTPYHPDPALKTHPMLPMQFHSFDRSVMVPVKKPPPGSLSVNTVATP
TTSGAAGAGSTPNIFAAATATPKSMINTTGATDSASSSSSSSSSFVNGATSKNLPAVQTV
APMPDDTMENMSITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMK
SSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNR
QRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKH
GAWGTMSQSQLHDFWRLDYWEDDLRRRRRFVRNASGSTHADVSLKALEEYGTEEEEEELK
SKKTFRSQSVVTQNPEAELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLVAPVVVARG
TLSITTTEIYFEVDEEDPTFKNTDAKVLAYSEGLHGKWMFSEIRAVFSRRYLLQNTGLEV
FMANRTSVMFNFPDQATVKRVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRW
QRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNFDSEELDLTLPGNFRDLSKPIGA
LNPKRAAFYAERYETWDDDSTPPHHYTTMYSTAHSTLMWMLRIEPFTTFFLNANDNKFDH
PERAFSGIGCSWRNCQRDTADVKELIPEFYYLPEMFVNSNEYELGVRDDGVSACDVELPS
WAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFNFLSYEGSINL
DNADASQREVIESQIQACGQIPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMV
LKFPSNSPVTHVAANTLPHLSIPAAVTVTCSRLFAVNRWHNTVGLRGAPGYSLEQAHHLP
IEMDPLIANNSGVNKRQITDLVDQSIQINTHCFVVTADNRYILVCGFWDKSFRVYSTETG
KLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYP
APRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPELCQRPRLIS
VSSEGHCIIYYERGRFCNFSINGKLLAQMEVNDSTRAILLSSDGQNLVTGGDNGVVEVWQ
ACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences G3QBB1
ENSGACP00000027177 ENSGACP00000027177 69293.ENSGACP00000027177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]