SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027178 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027178
Domain Number 1 Region: 842-1141
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-117
Family BEACH domain 0.000000000113
Further Details:      
 
Domain Number 2 Region: 1253-1506
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-31
Family WD40-repeat 0.0062
Further Details:      
 
Domain Number 3 Region: 730-837
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-28
Family PreBEACH PH-like domain 0.00000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027178   Gene: ENSGACG00000020556   Transcript: ENSGACT00000027230
Sequence length 1519
Comment pep:known_by_projection group:BROADS1:groupVII:20107491:20129917:1 gene:ENSGACG00000020556 transcript:ENSGACT00000027230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSTELENIEATQGMSSETAVTFLS
RLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRSCK
SSLTSSKSQDSLHSASTTGKVPHTQDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAV
VYFISVLMVSKYRDILEPQREIGRSTSLSGRSIRHEINSPTSTEHPSTAFSDRDKQTPTP
VDDSPRVGLPHTDSGIGEEGHVAGSLNGSEMGLGLGLGLVGRETDRDRDIGGGGTDLLCS
LSDVRRSQESLLDSPHNPNSSQAPPSSISSISQTSKGINVKEILKSLVAAPVDGGDSGQD
SGPTPYHPDPALKTHPMLPMQFHSFDRSVPLTRRKGFVSRSGFVSSLSTSLSSSLGATDS
ASSSSSSSSSFVNGATSKNLPAVQTVAPMPDDTMENMSITTKLERALEKVAPLLREIFVD
FAPFLSRTLLGSHGQELLIEGTGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIEL
INEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDH
LISAAKHRDHVTANQLKQKILNILTNKHGAWGTMSQSQLHDFWRLDYWEDDLRRRRRFVR
NASGSTHADVSLKALEEYGTEEEEEELKSKKTFRSQSVVTQNPEAELMLEGDDDAVSLLQ
EKEIDNLAGPVVLSTPAQLVAPVVVARGTLSITTTEIYFEVDEEDPTFKNTDAKVLAYSE
GLHGKWMFSEIRAVFSRRYLLQNTGLEVFMANRTSVMFNFPDQATVKRVVYSLPRVGVGT
SYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFP
WVLTNFDSEELDLTLPGNFRDLSKPIGALNPKRAAFYAERYETWDDDSTPPHHYTTMYST
AHSTLMWMLRIEPFTTFFLNANDNKFDHPERAFSGIGCSWRNCQRDTADVKELIPEFYYL
PEMFVNSNEYELGVRDDGVSACDVELPSWAKKPEDFVRINRMALESEFVSCQLHQWIDLI
FGYKQRGPEAVRALNVFNFLSYEGSINLDNADASQREVIESQIQACGQIPSQLLIEPHPP
RSSAMHLSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLSIPAAVTVTCSRLFAVN
RWHNTVGLRGAPGYSLEQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINTHCFVVTA
DNRYILVCGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDAT
LLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVH
TITGDLLRALEGPELCQRPRLISVSSEGHCIIYYERGRFCNFSINGKLLAQMEVNDSTRA
ILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGS
IVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences G3QBB2
ENSGACP00000027178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]