SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027217 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027217
Domain Number 1 Region: 1249-1410
Classification Level Classification E-value
Superfamily PH domain-like 4.14e-70
Family Pleckstrin-homology domain (PH domain) 0.000000367
Further Details:      
 
Domain Number 2 Region: 1048-1252
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-53
Family DBL homology domain (DH-domain) 0.000000026
Further Details:      
 
Domain Number 3 Region: 443-543
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 838-911
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000958
Family PDZ domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027217   Gene: ENSGACG00000020582   Transcript: ENSGACT00000027269
Sequence length 1597
Comment pep:known_by_projection group:BROADS1:groupVII:20634688:20663734:1 gene:ENSGACG00000020582 transcript:ENSGACT00000027269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNGDSGFYGDVTAHLSRKHTSRSLRISSKQPVARRPRHSSSVKQEHRNSDASTR
SSSTPSIPQSLAENGLGAFNAADAFGEFGINPHWTQRVAMTMRPESYQQDDDPLATPTPE
TSEADTVAPAGGEDSNVVGEERYLQRMTEGPREGGSFKKKRSKSADMWREDSLEFSMSDL
SQEHLTSTEEMIGGGEEEEEEEQFARPRGNAGSAERASSLDHLCSQQSPGLRGQRSRYAK
NRREAPCDGDGGGDEGLMSPSEEDGGGYGAFTLPCRRSHCLSEGRFQGRRAQTTQDISGV
LGEGSEYGDSGIDGVATEIDGDGELVSRRCKAMSASFSVYSATESSLFNGSDSGSSSAGG
GGGRAGDGGRGGVYENFRKELDNQAWTHQGRDCAEEAASAVSDERSSCTLSGAYPSDIPI
GCAQGIVRKAGALAVKNFLVHKKNKKVEPATKRKWKHYWVSLKGCTLFLYESDGRSGIDH
NSVPKHALWVENSIVQAVPEHPKKDFVFCLSNSVGDAFLFQTSGQTELENWITAIHSACA
AALARQHHREDTVRLLRTEIRKLEQKIDMDEKMKKMGDMQLSTVTDAKKRKTILEQIFLW
EQNLERFHMDLFRCRCYLASLQGGEPPNPKRLLGFASRPTKLAMGRLGIFSVSSFHALVS
ARTESSIRRRNQAMPRTFSKRRSRFSSLWGLDTTSKRKSKGHPSLNQVFVDGMEPVKKPL
ERMFEDSASEKSKEKEASVKNLPQQNIDSDIWVPDYLAPSWVCLPNNHPVLAIVQPGETA
LEVLSSVCKTHKIDSSSHYLRLKMWIDNRILFYVPKIEEDISDLLYKEIEVRPKATKVIR
FDKAESSAIGFGFSVAVIDEEGTQQLHITEVKAEGLAAAKGLKAGDEILLLNGKPASALQ
MDDMRAAFVNQALTLSVSTLPQLDPRVLCCLPPRRSDGEQDPATDIFSQSQGKRKHSYSS
IRRNQCSTVQISHNSPDVEGVPSDVFSLSPQSTEQVTAFCRSLHDMNPLERPMSSSSSSS
SSSLSPSPVSALPPAAGIATQRQLSHADKLRKVINELVETEKTYVKDLRCLIECYLTPLQ
KESFLTQDELDVLFGNLGEMVEFQVEFLQTLEDGIRLVPDLDRLEKVAQFKKVLFSLGGS
FLYYADRFKIYSAFCASHTKVPKVLAKAKTDPDFKAFLAERNPRQQHSSTLESYLIKPIQ
RVLKYPLLLRELHSLTHPDSEEHYHLDVAMKAMNKVASHINEMQKLHEEYGAVFDQLIND
QTSDKKEVADLSMGDLLLHSTVVWINPPAFLVKSKKERDMAAFVFKTAVVFVYKDSSKHR
KKIGGTHRASVIDDKDPFRFRHMIATDSLQVRAPASSDSEGTAVCEIVHTRSESEGRPEA
TFQLCCSSPDSKKDFLKAVHSILREKQRRQLLQTESLPPNQRYVPFGGKRLCALKGARPA
MNRAASAPSRRLPRRKQARNRFTIDTDLVRHGNNSNKPQGEDTDRWVEEQFDLGRYEEPG
DSINVGQMKETDILSDDDDYCKSVRAASAEPDRLEGRMEGLDLRVNEARGHNLNGGAGSE
LGPLKQCVAEGATSKSRDVIWVRRDNFANGCKNNPNV
Download sequence
Identical sequences G3QBF1
ENSGACP00000027217 ENSGACP00000027217 69293.ENSGACP00000027217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]