SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027237 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027237
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-36
Family VPS36 N-terminal domain-like 0.00000159
Further Details:      
 
Domain Number 2 Region: 279-384
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-26
Family Vacuolar sorting protein domain 0.084
Further Details:      
 
Domain Number 3 Region: 187-300
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000015
Family Vacuolar sorting protein domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027237   Gene: ENSGACG00000020595   Transcript: ENSGACT00000027289
Sequence length 384
Comment pep:known_by_projection group:BROADS1:groupVII:20902181:20906229:-1 gene:ENSGACG00000020595 transcript:ENSGACT00000027289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRFSWSNGLLEINETLVIQQRGIRLYDGDDKAKLDSGVALLSTHRLIWRDVKNHECCIA
MPLSQIVFFEEQAAGIGKSAKIIIHLHATPANKETGPYQHSKYSFIKLSFKEHGQIEFHR
RLTEEMTQKRWESTPASQPIPTATGSQTGRTRAVGIVGIERKIEEKRKETDKNISEAFED
LSKLMVKKQAKEMVELSRSIANKIKDKQGNITEDETIRFKSYLLSMGIADPVTRETHGSG
THYHMQLAKQLGDMLQVPLEERGGMMALTEVYCLVNRARGMELLSPEDLVNACKVFESLK
FLCRLRVFDSGVMVVQLQSHSEEEMISSALDNVSDKGSLTAEEFAKLLGLSVLLSKERLL
LAEKMGHLCTDDSVEGLRFYPNLF
Download sequence
Identical sequences G3QBH1
69293.ENSGACP00000027237 ENSGACP00000027237 ENSGACP00000027237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]