SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027288 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027288
Domain Number 1 Region: 292-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00000173
Further Details:      
 
Domain Number 2 Region: 4-184
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.53e-48
Family BAR domain 0.0043
Further Details:      
 
Domain Number 3 Region: 159-265
Classification Level Classification E-value
Superfamily PH domain-like 3.82e-16
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027288   Gene: ENSGACG00000020630   Transcript: ENSGACT00000027340
Sequence length 694
Comment pep:known_by_projection group:BROADS1:groupVII:21590222:21596520:-1 gene:ENSGACG00000020630 transcript:ENSGACT00000027340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQNADDLISPLERFRKEQIGAVKEGKKQFDKETERYYSVLEKHLSLSSKKKESHLNEADS
QMSKDRQVFYDASLQYVFKIQEVQERKKFEFVEPLLAFLQGLFTFYHEGYELASEFEPYK
QQLQFNLQNARNNFESTRVEVERLMKRIRSAEEDFKAPSCFTMEGYLYIQEKRPLGSVWT
RYYCTYEKSTKMFTMSNTETRPASRQNGVPNGTPEMFKLRSCVRRKTDSIDKRFCFDIEV
VERHSVITLQALSEANRRLWMEAMDGKEPIYTLPSLLSKKEETFLNKAGFNFVNKCIELV
ETRGITTLGLYRTGGVNSKVQRLMTTVFASTAPTDMQLDPDTWDNKTITSGLKNYFRCLA
EPVLTYRLHKEFIKAAKHDDQKYRVRAIHALVHKLPEKNRAMLDILTNHLLKVSLHNDQN
MMTVSNLGMIFGPTLMRSQEETVAAMMNIKFQNIVVEIIIENHHKIFGEAPDLSVPIPQP
PSSRSAPRRNKAICLSSGKRRARLYPPALCLADNDSDTFSSSPSTTPMGSQESLSSHSSE
KNGLSQTSPPSSPTAQPDSSSSAQVSPHAAPSCSPPHDSSNGKDRTGPTDGAASPRFTPS
SSRTSSELTPAQQTSSVSSSTFPYRLSTSSSLTSLHISEDYKSCHGSVQSLMSLDPLEAT
HKRKPAHTRCGSDVIGKHSAAASSSNGYQRPGSL
Download sequence
Identical sequences G3QBM2
69293.ENSGACP00000027288 ENSGACP00000027288 ENSGACP00000027288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]