SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027334 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027334
Domain Number 1 Region: 607-706
Classification Level Classification E-value
Superfamily PH domain-like 2.25e-26
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027334
Domain Number - Region: 184-303,608-628
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00126
Family FCH domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027334   Gene: ENSGACG00000020668   Transcript: ENSGACT00000027386
Sequence length 717
Comment pep:known_by_projection group:BROADS1:groupVII:22160024:22168326:1 gene:ENSGACG00000020668 transcript:ENSGACT00000027386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGQRVGSISSLNGKEELRDYHQHQRDERLREQKVQRLECQRLETILNLCTEFGHVEKEPG
AGEAAGVGRRVGVLRLSRPRRLPTGRGAAGQPASAGRLQRRQVPLARRQPQQQRPLAVQP
PQSQIEDEVLESAQLKQEVTHIEEERIQVVNNIEELEQKIKDLDNQMEESVREMEVECAL
LEGEQESEMTQLQREKELLDQLNKKIHSIQTTSPPEKHQDTEEQTKSLEDLEFQKLERKM
NQDEEKENQSKELLREIAEGQRTAVTRKERIMALKKQSSQITLQAQQERDNFQREKNNLL
VMLQKEREKLASLEGKYAELSEGQSFTNNPVAMKEERRRSNKENSCHPSDSQPYKRSQQL
LTSYGRSLGRTLPPKVIITSWNTSCPLASVPKLQLWQRHPTRLQLLPPRPERPPPDQELS
SHDGNGHSHANEDRQRRSDFFNRMISEPSVFLDSFTYPDHSQASDTVSVDSSDSLETSYS
ACSPDNISSASTSNMAKIEEMERLLREAHAEKLRLLEHREREMEMRRHALEEERQRREEL
EKRLQEETSRRQKLVEREVKLREKQRSQSRLLTRYLPVRKDDFDLHGHIEAAGHSPDACF
HLAITDKTCRGFLVKMGGKIKTWKKRWFVFDQNRRTLTYYADKHETKVKGVIYFQAIEEV
YYDHLKNAHKKSPNPSLTFSVKTHDRVYYMVAPSPEAMRIWMDVMVTGAEGHMHFMV
Download sequence
Identical sequences G3QBR8
69293.ENSGACP00000027334 ENSGACP00000027334 ENSGACP00000027334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]