SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027402 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027402
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.07e-75
Family BAR domain 0.0034
Further Details:      
 
Domain Number 2 Region: 392-569
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.000000133
Further Details:      
 
Domain Number 3 Region: 719-800
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 4 Region: 263-363
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000287
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027402   Gene: ENSGACG00000020726   Transcript: ENSGACT00000027454
Sequence length 801
Comment pep:known_by_projection group:BROADS1:groupVII:23208162:23253092:-1 gene:ENSGACG00000020726 transcript:ENSGACT00000027454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDCYLDSPQFRERLKSHELELDKTNKFIKELIKDGKALVQALKSLSTAKRKF
ADSLNEFKFQCIGDAETDDEICIAKSLQEFATVLQNLEDERTRMIENANDVLITPLERFR
KEQISAAKEARKKYDKETEKYCAVLEKHLSLSAKKKESHLHEADNQVDNVRQHFYEVSLE
YVFKVQEVQERKMFDFVEPLLAFLQGLFTYYHHGYELAKDFNHFKTDLTISIQNTRNRFE
STRSEVESLMRKMKENPHEHKSVSQHTMEGYLFVQEKREYRHTWVKYYCTYHREPKRVTM
VLFDPKSGGKTILLEFYIRKYTTCNRTNTSIIPFAFEVEGGRTGVITMQALSEEDRRLWM
EAMDGREPVYNLNRDNQAEGLAQLDVIGFNVMKKFIHAVETRGIDDQGLYRIVGVSSRVQ
KLLGLAMDPKTCADVELENSEWEIKTITSAIKHYLSRVLPGPLMTYQYQRSFIKAAKLDN
QEARVTEVHALVHRLPEKNRQMLELLMKHLATVASHHHQNLMTIANLGVVFGPTLLRPQE
ETVAAIMDIKFQNIVVEILIEHHEKIFRDVPASAGGPTSLQPNQSRRRSTDSKAPSCSER
PLTLFHTPTHSQKGEKRNSAEPPPPVPSSANSVNTDTRELQPNLFEDNVCWPSLKVVILA
PTVTSSINATSPSPTSPRSPSWPMFSAPSSPGPTSSASSDSSPVRSVNVLLRPAKPHLSD
LSHKSPQKPLTHSRSVSLSPSIAGRKARALYACKAEHNSELSFIAGTIFENAVHGSREPG
WLEGTLDGRTGLIPKNYVEFL
Download sequence
Identical sequences G3QBY6
ENSGACP00000027402 ENSGACP00000027402 69293.ENSGACP00000027402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]