SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027459 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027459
Domain Number 1 Region: 161-442,529-647
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0028
Further Details:      
 
Domain Number 2 Region: 18-68
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000459
Family UBA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027459   Gene: ENSGACG00000020768   Transcript: ENSGACT00000027511
Sequence length 1090
Comment pep:known_by_projection group:BROADS1:groupVII:24214696:24228941:-1 gene:ENSGACG00000020768 transcript:ENSGACT00000027511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVYLTPDCCFPLSDLFTRQSKILIDQLREITGIQDPQVLNRALNASQGDIGNAVGLLTT
QPAEVQDPGETQEPGPSAEAWDGQKGTLGLLSDFSGPPKDELQTAIELSLQESHKAQEEE
REFNRALEASAEENAARMKRKRCQAQSEMCSPADWIRQDDWPVGIRNVGNTCWFSAVIQS
LFHLPVFRRLVLSYHLSERILEKCKSHSDKRNIAFMQELRCLFALMVGSTRRFVDPSAAV
ELLRDAFRTNEAQQHDVSEFSHKLLDWLEDAFQLAANDFSKVEDKQKNPMVQLFYGTFVT
ERRHEGKTLCNIEQFGQYPLQVNGFNNLDECLEGAMVEREIESLHSEHSVTSGRERWFKK
LPPVLTFELSRFEFNTQLGRPEKIHKKLEFSQIIYMDRYLHKNIGQTHERRGEVKKLKEQ
LAALQQKLECYKNYGSGPTKYPLADMLQFVLEFSTTKPTCVSPAEDLGPASPTPASHPLS
DLISKDNSEPEDSDASEGAVSGVSSCQRTPIYKPFTQCRLPVDCPPHPAPHSVTEEELHF
VKTCLQRWRTEVENDINELKASIDRLTQVLEGMYADNCLCQAPYRLHAVLVHEGQASAGH
YWAYIYDHANQRWMKYNDISITESSWEELERDSFGGMTNASAYCLMYIDDRLPNLITEDT
DDETGQVLHGMDSLPPVLRRYVHEDNRWFQQELSEWEAQFCQTATPQGESTASAEPPELG
PFISPSVSCSEGYNLIAYIYSAVPARQRQTENMVSEVEIPNVGRIMVRADADGYNEEVMM
LTPAMQGVILAIAKARHIFDKEGPEAGLIKAFHEEYSRLYELSQEETTPPEDARLQHALV
YFFQNKAPNRIIERTLLEQFTDRNLSFDERCRAISIMREARTKLRLIRPEDMDMDEYMQW
QDDYRLFRTVFVYLLAGLEHYQYGKMREALIFLAHAYETNATLLKNGEKRGVDKSLIAVY
RRKCLIALNESASRLFCSGEETNVAEGTAIMDEAVIPCLHLMGRDSALSREDRDAMESIR
SHWCCCLGQGMDDSLQVKLGEFLPRVLDGSSETVVLKDPPNVHVSQAHDLCSRLAAVMES
IHSTSVVSVK
Download sequence
Identical sequences G3QC43
ENSGACP00000027459 ENSGACP00000027459 69293.ENSGACP00000027459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]