SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027471 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027471
Domain Number 1 Region: 51-290
Classification Level Classification E-value
Superfamily L domain-like 4.76e-26
Family Internalin LRR domain 0.074
Further Details:      
 
Domain Number 2 Region: 345-423
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000226
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027471   Gene: ENSGACG00000020777   Transcript: ENSGACT00000027523
Sequence length 425
Comment pep:known_by_projection group:BROADS1:groupVII:24894073:24901097:1 gene:ENSGACG00000020777 transcript:ENSGACT00000027523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSSDEEEVRTFIQVLSEKYSPENFPYGQGVVVMPSPPGSPVKDRLYLPNILVLSDSGI
GKAGERSDIAAFCAHVVELDLSHNQLNDWAEICDIVSNIPNLDFLNLSMNPLSGIELEPS
MAEVFPRVRQLVLINTHVSWETVHKLTQNAPELEELFLCLNGYNTVSESQTSCPSLRLLQ
ITDNQLEAWAEVRKFGQMYPSLRTLVLANNSVDSVGDSHDALQQLFPNLRSINLNNSGLS
RWEDIERLNFFPKLEEVKAKGIPLLESYTTHDRRSLLLAQLPSVKRLNGSLVTTGEREDA
ERLFIRYYQENPQQQLPERYHVLVSKYGELAPLAEVDLRPRRTTVDVRWGDRVEAVALRL
EQTVGDLKKHLRALLQLPANGVRLFYINREMSSVVGPEEMRCGSRALHSYSIRDGDEILV
VPKVK
Download sequence
Identical sequences G3QC55
69293.ENSGACP00000027471 ENSGACP00000027471 ENSGACP00000027472 ENSGACP00000027471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]