SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027487 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027487
Domain Number 1 Region: 45-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.83e-254
Family Motor proteins 0.000000000373
Further Details:      
 
Domain Number 2 Region: 1962-2078
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-22
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 3 Region: 2079-2169
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-20
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 4 Region: 1222-1325
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-19
Family First domain of FERM 0.034
Further Details:      
 
Domain Number 5 Region: 1862-1970
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000372
Family Ras-binding domain, RBD 0.084
Further Details:      
 
Domain Number 6 Region: 1317-1411
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000101
Family Second domain of FERM 0.0061
Further Details:      
 
Domain Number 7 Region: 1593-1642
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000802
Family SH3-domain 0.0039
Further Details:      
 
Domain Number 8 Region: 791-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000111
Family Motor proteins 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027487   Gene: ENSGACG00000020788   Transcript: ENSGACT00000027539
Sequence length 2183
Comment pep:known_by_projection group:BROADS1:groupVII:25171729:25190592:1 gene:ENSGACG00000020788 transcript:ENSGACT00000027539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVILQQGDYVWLDLKTGREFDVPVGAVVKLCDSGQIQVLDDEGREHSISPQNATNIKPMH
PTSIHGVEDMIRLGDLNEAGILRNLLIRYNERVIYTYTGSILVAANPYQLLPIYSPDQIR
LYTNKKIGELPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYVDIHFNKRGAIEGAKIEQYLLEKS
RVCRQAPDERNYHVFYCMLKGMAPEMKAKLGLGLASDYSYLTMGKCTACDGRDDLSDYSS
ILSAMKVLMFTETENWEISKLLAAILHMGNLRFEARTYDNLDACVVVRSPDLITAASLME
VDPKDVMVCLTTRTLITRGESVATPLSVDQGLDVRDAFVKGIYGRLFIWIVDKINAAIYR
PPSCESNIMRRSIGLLDIFGFENFILNRCITNHHHRSSNILFRAALKLEQEEYNLEDISW
QHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDATMLYKLNSQHKLNCNYVPPKNS
YATQFGIQHFAGVVNYETRGFLEKNRDSLHTDIIQLVHSSRNKFIKQIFQADVAMGAETR
KRSPTLSSQFKRSLEMLMRTLSVCQPFFVRCIKPNELKKPMLFDRELCIRQLRYSGMMET
IRIRRAGYPIRYTFGEFVDRYRVLMPGVKPAHIQDDLRGTCQKIVLARLGNYDDWQIGKT
KIFLKDHHDMQLEIERDTGITDKVILIQKAVRGLIDRNHFLRLRRAVTFLQKVWRGYLCR
KNYRTMQSGFLRLQAVYRSRKHFKSYRTTRRRVTLIQARCRGFLVRQAFWRRLGAVLTLQ
AYTRGMIARRLCQRLRAELQHRLEAERQRLAEEEQLRYQMTARRAKAEAERKHQERLVML
DQRPVDHSDMVDRMFGFLGSAGPLPNQDGRAPAGFEDLEKTPDREEAEEEVLDEAMPLPD
EEDEDLSEYKFSKFAATYFQGVSTPTYIRRPLKQPLLFHEDEGDQLAALAVWITVLRFMG
DLPEPKCQMVINDGSEKIPVMTKIYETLGKRTYKRELQELQVEGENSSVDAQKRNSVRHK
LVSLTLKRKTKITEEVTRRLTEVDYGLQGNSMLEDRPTSNLEKLHFIIGNGILRPALRDE
VYCQICKQLTQNPSKSSHARGWILLSLCVGCFAPSEKFVKYLRTFLINGPPGYAPYCEER
LRRTFVNRTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLADSATSASELCNALADK
INLRDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEI
FNPWHNPAEDYVATNLIYQQIVRGVKFGEYRCEREEDLAELASQQYYVDYGSELLQDRLL
TLIPSYIPDREITTTKTAEKWAQLITNAHKKGFHSKRRLTPQKVKEDVVDFARLKWPLLF
SRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSRYSMTSFA
VGFKAKFCTNPTSELTIMNIIASKRSSCRGGKLQGQSFTLATIKADEYTFTSNNAEDIRD
LVVAFLEGLRKRSKYVVGLLDCSNPAGVESTFLSFSKGDLIVLDEHDGEHVMNSGWAHGI
NDRTKQRGDFPADCVYVVPTITRPQYDIVALVTMTPDQRRESIGLSHTSVSGIEDKSKAY
SLEEFSYDYFRPPPKSTLSRVMISKSRGKDRLWSCTREPLKQPLLKKVLAHEELSQEAVL
AFIAVMKYMGDYPSKRVRSVNELTDQIFEGALKAEPLKDEIFCQILKQLTDNHIKYSEDK
GWELLWLCTGLFPPSNTLLPHVQKFLQAKKHHQLAPDCMQRLQKALRNGSRKYPPHLVEV
EAIQHKTTQIFHKVYFPDDSDEVFEVESSTKAKDFCHNISGRLLLKSSEGFSLFVKITDK
VISVPDGDFFFDFVRHLTDWIKKARTVKDGAVPSLTYQVFFMKKLWTNTVPGKDSMADSI
FHYYQELPKYLRGYHKCPKEEVHQLAALIYKVKFDDDKTHFQNISKILKELVPQDQIRHL
PPDEWKRAIVSLFNKHSGKTREEAKLSFLKIIYKWTTFGSAFFEVKQTTDPSYPETLLIA
INKHGVSLIDPKSREILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDD
LLTSYISQMLTTMTKQRTSRRSS
Download sequence
Identical sequences G3QC71
ENSGACP00000027487 ENSGACP00000027487 69293.ENSGACP00000027487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]