SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027640 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027640
Domain Number 1 Region: 272-406
Classification Level Classification E-value
Superfamily PH domain-like 5.7e-37
Family Phosphotyrosine-binding domain (PTB) 0.0000238
Further Details:      
 
Domain Number 2 Region: 104-249
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-28
Family Phosphotyrosine-binding domain (PTB) 0.021
Further Details:      
 
Domain Number 3 Region: 19-61
Classification Level Classification E-value
Superfamily WW domain 0.0000000000638
Family WW domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027640   Gene: ENSGACG00000020903   Transcript: ENSGACT00000027692
Sequence length 482
Comment pep:known_by_projection group:BROADS1:groupVII:27746208:27752961:-1 gene:ENSGACG00000020903 transcript:ENSGACT00000027692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGKDYMLAILIVNYDDNIWTDQNLQLDPDLPSGWRTIKDSTGTYYWHVPTGATQWQHPR
FELSRAESAGRDVGLDQVLDGSWTPSIHSNKNCVFLLRSLRHEDYLRYHNPNSKWFAVRS
LGWLEVEEEDLSPGRSSLALSNVIQQLSHCGSPEQRDRQGARGEGQEMMLVLKKDTLTLL
DPLDHTSLHCQPISNIRVWGVGCNNGRYRDFAFVAGDKDSCVLKCHVFRCDAPAKAIAMA
LHEMCSKMMSEKTSMRPSRSLTMESISPEDLPRQVEFQEAMRKQVQKFDVQYVGNLPVSR
AMGMEVLNRAIESIMNSTDRDEWEATVIHITDNILSLWKGKEGEEPLWECQVRFLTFLGV
GHDSRTFAVIVDGGTQRFECHVFWCEPDAGNLSEAVQGACMVQYQKCLVAQTPPPRTKSW
RAASSKVKRANSVDSFPPITSNLQGNSNSGGAMIPRMTKGDSGVRRGMLAFFETFQKQAA
IS
Download sequence
Identical sequences G3QCM4
ENSGACP00000027640 ENSGACP00000027640 69293.ENSGACP00000027640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]