SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027651 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000027651
Domain Number - Region: 63-139
Classification Level Classification E-value
Superfamily PH domain-like 0.000669
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027651   Gene: ENSGACG00000020911   Transcript: ENSGACT00000027703
Sequence length 170
Comment pep:novel group:BROADS1:groupVII:27836064:27840378:-1 gene:ENSGACG00000020911 transcript:ENSGACT00000027703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLNNQLICAADNKEALLSHLVHILKVILPGGVSNEKMVGASAVSKVRPVDVGGSSSHS
DAWLLLMEDGVSLLPVHKHTQQTLMMDLDMISHHEMDPTENFITMVTADRRVSLRFEEQH
SCECWFTQLQVALRRCTPTANGGAARRSLYPVKDLLRGSVPPAIERCISH
Download sequence
Identical sequences G3QCN5
ENSGACP00000027651 ENSGACP00000027651 69293.ENSGACP00000027651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]