SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027652 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027652
Domain Number 1 Region: 163-204
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0000000000000575
Family Pyk2-associated protein beta ARF-GAP domain 0.012
Further Details:      
 
Domain Number 2 Region: 83-192
Classification Level Classification E-value
Superfamily PH domain-like 0.000000308
Family Phosphotyrosine-binding domain (PTB) 0.064
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027652
Domain Number - Region: 3-73
Classification Level Classification E-value
Superfamily PH domain-like 0.000227
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027652   Gene: ENSGACG00000020912   Transcript: ENSGACT00000027704
Sequence length 207
Comment pep:novel group:BROADS1:groupVII:27841390:27842818:-1 gene:ENSGACG00000020912 transcript:ENSGACT00000027704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWKKRTDRFSEVLFHVSSITNVKKQDKGRFSVNIRKKNYDFMAHNEEVQKGWVTSLLA
TRGQPSPAPPELHGPITIRDPRSRVYAAVWGHDLWIYPNKEGFQLGIASFSVPLNVALVK
CTGKHSFSLITPYKSFNLSVDSSKELPVWLDGLSLSIRSALSNSNVVLRLWENPDNKVCG
DCGSANPEWASVNLLLVICQACAGTVT
Download sequence
Identical sequences G3QCN6
69293.ENSGACP00000027652 ENSGACP00000027652 ENSGACP00000027652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]