SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002100 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002100
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 3.28e-85
Family Integrin A (or I) domain 0.000000234
Further Details:      
 
Domain Number 2 Region: 357-469
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-19
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 639-727
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.09e-18
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 4 Region: 25-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000361
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 597-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Integrin beta EGF-like domains 0.0023
Further Details:      
 
Domain Number 6 Region: 555-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Integrin beta EGF-like domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002100   Gene: ENSGACG00000001584   Transcript: ENSGACT00000002105
Sequence length 799
Comment pep:known_by_projection scaffold:BROADS1:scaffold_169:109604:124646:1 gene:ENSGACG00000001584 transcript:ENSGACT00000002105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRLLLIASLSAVLGGSWAQQEGSICIKANAQSCGECIQVAETCGWCADETFLTVGESK
SARCDDLESLKKRGCSLTKIENPRGGIRIDQNKTVTNRKKDVAEKLTPEQITQIQPQKLS
LTLRSGEPQTFELKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMREMQGITSDF
RIGFGSFVEKTVMPYISTTPARLINPCTGNQNCTSPFSYKNVLKLTDKGDEFNRLVSQQQ
ISGNLDSPEGGFDAIMQVAVCENQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGR
CHLENNMYTMSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SSNSSNVIKLIIDAYNSLSSEVILENSRLPEGVSITYKSICKNGVEGTGENGRKCSNISI
GDEVLFHISIESQKCPSHGKPEVIKIKPLGFTEEVEVVLTFICDCPCAKNGVTNSDQCSE
GNGTFECGACKCNDGRIGRLCECSKDEVRTEDLDANCRKDNGTDICSNNGDCVCGTCECK
KRENPAEIYSGKYCECDNFNCDRSNNKLCGGHGRCDCRKCICDANYTGSACDCSLETATC
LAKNGQICNGRGTCECGACKCTNPKFQGPTCEICPTCPGVCPEHKDCVQCRAFEAGEKKD
TCERDCSYFQLMKVKDRDKLPQPADQSYPLSHCKERDANDCWFYYTYAIRNDTKEVYVVE
TLECPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGE
NPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences G3N9V8
ENSGACP00000002100 ENSGACP00000002100 69293.ENSGACP00000002100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]